KEGG   Bacillus licheniformis ATCC 14580: BL00293Help
Entry
BL00293           CDS       T00197                                 

Gene name
mmsA
Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase MmsA
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00280  Valine, leucine and isoleucine degradation
bli00410  beta-Alanine metabolism
bli00562  Inositol phosphate metabolism
bli00640  Propanoate metabolism
bli01100  Metabolic pathways
bli01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BL00293 (mmsA)
   00562 Inositol phosphate metabolism
    BL00293 (mmsA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BL00293 (mmsA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BL00293 (mmsA)
Enzymes [BR:bli01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     BL00293 (mmsA)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     BL00293 (mmsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AAU23628
UniProt: Q65IX1
Position
complement(2046159..2047613)
Genome map
AA seq 484 aa AA seqDB search
MITTNAKKMMNHIDGEWVNSLGAESEEVVNPANGNVIAYAPLSVRADVDRAVQAAKHAYQ
TWSLVPVPNRARLLYKYLQLLQEQKEQLADIITTENGKTLKDARGEVQRGIEVVELATAT
PTLMMGESLPAIAGGIDGSIWRYPLGVVAGITPFNFPMMVPLWMFPLAIACGNTFVLKPS
ERTPILAGKLVELFYEAGFPKGVLNLVHGGKDVVNGILENDDIKAVSFVGSEPVAKYVYQ
TGTANGKRVQALAGAKNHAIVMPDCHLEKTVQGIIGAAFGSSGERCMACSVAAVVDDIAD
DFMEMLVSETRKLKTGDGRSEDHFVGPLIREVHKQRVLDYIDSGIKEGAALAVDGRNPDV
REGYFVGATIFDHVTPEMKIWQDEIFAPVLSVVRVQDLDEGIELANQSKFANGAVIYTSS
GKSAQQFRDKIDAGMIGVNVNVPAPMAFFSFAGNKASFYGDLGTNGKDGVQFYTRKKVVT
ERWF
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgatcacaaccaatgcaaaaaaaatgatgaaccatatcgacggggaatgggtcaattct
ctaggtgcggaatcggaagaagtcgtcaatcctgcaaacggaaacgtcatcgcttatgcg
cctctatctgtgagagcggatgtagatcgtgccgtgcaggctgccaagcacgcttatcag
acctggtcgcttgtgcccgtccccaatcgggcaaggcttttatacaagtatttacagctt
ctccaggagcaaaaagaacaattggcagacattattacgacggaaaacggcaaaacgtta
aaagacgcccgcggcgaagtgcagcggggaatcgaagttgttgagcttgcgacagccaca
cctactttaatgatgggagaatccctgcccgcgatagccgggggcatcgacggatcgatt
tggcgctatcctttgggagtcgtcgccggcattacgccgtttaactttccaatgatggtt
cccctgtggatgtttccgctcgccatcgcctgcggaaacacgttcgtcctgaaaccttcg
gaacggactcctattcttgccgggaagcttgttgagctgttctatgaagccgggtttcca
aaaggtgtgttaaacctcgtccatggaggaaaggatgttgtaaacggaatattggagaac
gatgatattaaagccgtctccttcgttggttcagaaccggtcgcaaaatatgtgtatcaa
acgggcacagccaacgggaaacgcgttcaggcgctggccggcgctaaaaaccatgcgatt
gttatgccggattgccatcttgaaaagactgttcaaggcatcatcggtgcggcattcggc
agcagcggggaacgctgtatggcctgctccgttgcggcggtcgttgatgacatcgccgat
gacttcatggaaatgctcgtctctgaaacacggaagctgaagacaggagacggcagatcc
gaggatcactttgtcggcccgctgatccgcgaagtccataaacaacgcgtccttgactat
atcgacagcggtataaaagaaggggccgcactcgccgtagacggacgcaatccggatgtt
cgagaaggatactttgtgggagccacgattttcgatcatgtgacaccagagatgaaaatc
tggcaggacgaaatctttgcaccggtcttgagcgtcgtccgtgtacaagatcttgacgag
gggatcgagctcgccaatcaatccaagtttgccaacggcgctgtcatctacacatcgagc
gggaaaagcgcccagcagttccgcgacaaaatcgatgccggaatgatcggcgtcaatgtc
aacgtcccggctccgatggcgttcttctccttcgcagggaacaaagcctctttctatgga
gatcttgggacaaacggaaaggacggcgtccagttttacacgcgtaaaaaggtcgtcacc
gaacgctggttctaa

DBGET integrated database retrieval system