KEGG   Bacillus licheniformis ATCC 14580: BL00311Help
Entry
BL00311           CDS       T00197                                 

Gene name
ysnA
Definition
(GenBank) conserved protein YsnA
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BL00311 (ysnA)
Enzymes [BR:bli01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     BL00311 (ysnA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like PHTB1_N
Motif
Other DBs
NCBI-ProteinID: AAU24490
UniProt: Q65GG3
Position
complement(2867042..2867632)
Genome map
AA seq 196 aa AA seqDB search
MKEVIIATKNEGKVREFKAMLEPRGYDVKSLLDIGYTPEIEETGQTFEENAVIKAETISK
ETGKIVIADDSGLSVDYLGGSPGVYSARYAGEEKNDLANLKKLLKELEGVEKEDRSARFR
CALAICIPGQETKTVEGSVEGYITEEPRGTNGFGYDPVFLVKDKDQTMAELSSGEKNKIS
HRAEALKKLSALLDQA
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaagtcatcattgccacgaaaaacgaagggaaagtcagggaattcaaagcgatg
cttgaaccgaggggctacgatgtcaaatctttactggacatcggctatacacccgaaatc
gaagaaaccgggcagacttttgaagaaaacgctgtgattaaagcggaaacaatttcgaaa
gaaaccggaaaaatcgtgattgccgacgactccggcctgtctgtcgactatctcggcggc
agccccggcgtatactcggcccgctatgcaggagaagagaaaaacgatctcgccaatctg
aaaaagctattgaaagagctcgaaggggtggaaaaagaagaccgttccgcgaggttcaga
tgcgcgctcgcaatatgcattcccggacaggaaacgaaaacggtcgaaggttctgtggaa
gggtacattaccgaagagccgcgcggcacaaacggcttcggctacgacccggtttttctc
gtcaaagacaaagatcaaacgatggccgagctctcaagcggcgaaaagaacaaaatcagc
cacagagcggaagcgctgaaaaagctgtccgctttattggatcaagcgtaa

DBGET integrated database retrieval system