KEGG   Bacillus licheniformis ATCC 14580: BL00469Help
Entry
BL00469           CDS       T00197                                 

Gene name
yjjA
Definition
(GenBank) Putative Uroporphyrinogen III synthase YjjA
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00860  Porphyrin and chlorophyll metabolism
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BL00469 (yjjA)
Enzymes [BR:bli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BL00469 (yjjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Oxidored_nitro DUF5333 DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: AAU24346
UniProt: Q65GV2
Position
complement(2727491..2728318)
Genome map
AA seq 275 aa AA seqDB search
MGKGLNGRRIAIGASRKTDEMSTLIKKQGGVPLIRSLQGTVFLAEKEVGPDLRAFVETGA
DWVIFTTGIGTETLVSLAEKLGIGERYLQAIRRAKAASRGYKTIAALKKLGITPVAADED
GTTKGLIDSLQSHDFSGKRVMVQLHGENAPSLLQFLEEKGADVVPLLPYRHVAPDRETVA
LLCSEIINREVDAVCFTTAVQVRSLFHFAKENGYAEKIVQSFQDSVLAAAVGKVTAEALR
EEGVERLLAPDLERMGAMIVELARFYETEEGIRTQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
ttgggaaaaggattgaacggcagaagaattgccatcggagcatcgcgaaaaacggatgaa
atgagcacgctgatcaaaaagcaaggcggggttcccctcattcgctcccttcagggtacc
gtgtttttggccgaaaaagaagtaggccctgatttgcgtgccttcgttgaaacgggagcc
gactgggtgattttcacgaccggaatcgggacggaaacgcttgtcagcctagctgagaaa
cttgggatcggagagcgctatttacaagcgatccgcagggcgaaagcggcatcgagaggc
tacaaaacaatcgccgctttaaaaaagctcggcattacgcccgttgcggcggatgaagac
ggcacgaccaagggactgatcgactcgctccaatcccacgatttttccggcaaacgggtg
atggttcagctccacggcgaaaacgctccgtcactgcttcagtttttggaagagaaaggt
gcagacgttgttccgcttctgccgtatcggcatgttgctccagaccgggaaaccgtcgct
ttattgtgcagcgagatcatcaaccgtgaagtggatgcggtttgctttacaacggctgtc
caagtccgctcgctttttcatttcgcgaaagaaaacggctatgcggagaaaattgttcaa
tcttttcaagacagcgtgttggcggccgctgtcggaaaagtgacggcagaagctttaaga
gaagaaggagtcgaacgccttctcgctccggatctcgaacggatgggagcgatgattgtg
gagctagcgcggttttatgaaacggaagaggggataagaacacagtaa

DBGET integrated database retrieval system