KEGG   Bacillus licheniformis ATCC 14580: BL01285Help
Entry
BL01285           CDS       T00197                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase (beta subunit)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00020  Citrate cycle (TCA cycle)
bli00640  Propanoate metabolism
bli00660  C5-Branched dibasic acid metabolism
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01120  Microbial metabolism in diverse environments
bli01130  Biosynthesis of antibiotics
bli01200  Carbon metabolism
Module
bli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BL01285 (sucC)
   00640 Propanoate metabolism
    BL01285 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BL01285 (sucC)
Enzymes [BR:bli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BL01285 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AAU23364
UniProt: Q65JP0
Position
1785745..1786905
Genome map
AA seq 386 aa AA seqDB search
MNIHEYQGKEVLRKYGVAVPEGKVAFTADEAVKAAEALSSSVYVVKAQIHAGGRGKAGGV
KIAKSKEEVKAYAEELLGKTLVTHQTGPDGQQIKRLLIEEGCDIKKEYYVGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIVKEVIDPAVGLQSYQARKIAFAINIPKELVGQAVKF
MMGLYKAFTEKDCSIAEINPLVVTGDGKVMALDAKLNFDSNALYRQKDILEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATKQVGLTLPLVVRLEGTNVDLGKKI
LDDSGLNITSAESMADGAQKIVSLVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccaagggaaagaagtactcagaaaatacggagtggctgttccg
gaaggtaaagtggcatttacagcagatgaagcggtcaaagcagcggaagcgctgtccagc
tcggtttatgtcgtgaaagctcaaattcacgccggcggacgcggtaaagctggcggggtt
aaaattgcaaaatcaaaagaagaagtcaaagcctatgcggaagaattgttgggaaagacg
cttgtcactcaccagacgggtcccgacggccaacaaataaaacgcttacttattgaagaa
ggctgcgatatcaaaaaagaatactatgtcggcctagttctcgacagggcgacttcacgc
atcgtgctgatggcctctgaagaaggcggcacggaaattgaagaagtcgctgaaaaaaca
ccggaaaaaatcgtcaaagaagtgatcgatccggctgtcggactgcagagctaccaggcg
agaaaaatcgccttcgccatcaatattccgaaagagcttgtcggccaggccgttaagttt
atgatggggctgtacaaggcgtttactgaaaaagactgttccattgctgaaatcaatccg
ctcgtcgtcacaggggacggaaaagtcatggcccttgacgccaagctgaactttgacagc
aatgcgctatacagacaaaaagacatcttggagtacagagatctcgatgaagaagatccg
aaggaaatcgaagcatccaagtatgatttaagctatatttcgctcgatggaaacatcggc
tgcatggtcaacggagcggggcttgcgatgtcgaccatggacattatcaagcactacgga
ggggaaccggccaacttccttgacgttggaggcggcgcgacagccgaaaaggtaacggaa
gcgttcaagatcattttgtctgatcaaaacgtcaaagggatctttgtcaatattttcggc
ggcatcatgaaatgcgacgtcattgcagaaggcgttgttgaagcgacaaaacaagtcggt
ctgacattgccgcttgtcgttcgccttgaaggcaccaatgtcgatctcggcaagaagatc
ctcgatgattcaggactcaatattacgtctgcggaatcaatggctgacggcgcgcagaaa
atcgtatccttagtgaagtaa

DBGET integrated database retrieval system