KEGG   Bacillus licheniformis ATCC 14580: BL01369Help
Entry
BL01369           CDS       T00197                                 

Gene name
bsaA
Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00480  Glutathione metabolism
bli00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    BL01369 (bsaA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    BL01369 (bsaA)
Enzymes [BR:bli01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BL01369 (bsaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AAU23851
UniProt: Q65IA7
Position
complement(2277283..2277762)
Genome map
AA seq 159 aa AA seqDB search
MSIYDISVKTIKGEDTTLRPYKGKVLLIVNTASKCGFTPQYQQLQDLYETYKDRGLEILG
FPSNQFMNQEPGDEKSIEEFCSVNYGVTFPMFSKVNVKGDQIHPLFRHLTNKAKGMLGTK
AVKWNFTKFLVDQTGENVVRFSPQTNPKEMEETIQKWLG
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgtccatttacgatatcagcgtcaagacgattaaaggcgaggacacgacactgcggccg
tataaaggcaaagtgctgctcatcgtcaacaccgcctcgaagtgcggatttacacctcaa
tatcagcagcttcaagacttgtatgaaacatataaagaccgggggcttgagattctcggc
tttcccagcaaccaattcatgaatcaggagccgggcgatgaaaaaagcattgaagaattt
tgcagcgtcaattacggtgtcacgtttccgatgttttcgaaggtgaatgtaaaaggggat
caaatccacccgctgttccgccacttgacgaacaaggcgaagggcatgcttggaacaaaa
gcggtcaaatggaatttcacaaaatttctcgtcgatcaaaccggagaaaacgttgtgcgc
ttttcaccgcaaaccaatccaaaggagatggaggagaccattcagaaatggctgggctga

DBGET integrated database retrieval system