KEGG   Bacillus licheniformis ATCC 14580: BL01382Help
Entry
BL01382           CDS       T00197                                 

Gene name
gdh
Definition
(GenBank) glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00030  Pentose phosphate pathway
bli01100  Metabolic pathways
bli01120  Microbial metabolism in diverse environments
bli01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BL01382 (gdh)
Enzymes [BR:bli01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     BL01382 (gdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Polysacc_synt_2 Glucokinase THF_DHG_CYH_C PALP
Motif
Other DBs
NCBI-ProteinID: AAU24082
UniProt: Q65HM4
Position
complement(2484903..2485688)
Genome map
AA seq 261 aa AA seqDB search
MYPSLEGKTVVITGAGTGLGKAMALRFGAEKANVVINYFKEEENPEETVEKIESSGARAI
AVQGDVSKEDDVKALIRQAVDSFGSVDVMVNNAGVENEVPSEDLALEDWNRVISTNLTGM
FLGCREAIGYMLDHNIKGSVINMSSVHQQIPWPHFVHYAASKGGAKLLTETLALEYAPKG
IRVNAIGPGAIDTPINAEKFADPELKKGVIELIPIGYIGKPEEVAACAAWLASEEASYVT
GLTLYVDGGMTKYPGFQAGKG
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtatccaagtttagagggaaaaacggtcgttatcacaggggcgggtacaggccttgga
aaagcgatggcactgcgcttcggtgctgaaaaagccaatgtagtgatcaattatttcaag
gaagaagaaaatcctgaagagacggtggagaaaatagaaagcagcggagcgcgcgcgatt
gccgttcaaggagatgtctcaaaagaagatgatgtaaaagcgctgatcagacaggctgtt
gattcattcggttccgttgatgtgatggtgaacaacgcaggggtggaaaatgaagtacct
tctgaggatttggctctagaggactggaaccgcgtcatatcaaccaatttgacggggatg
tttctaggatgccgggaagcgatcggctatatgctcgaccataatattaaaggctcggtc
atcaatatgtccagcgtccatcagcaaatcccgtggccgcattttgtccattatgcggca
agcaagggcggggcaaaactgctgacggaaacccttgcccttgaatatgccccgaaagga
atccgggtaaacgcgatcggccccggtgcaatcgatacgccgattaacgccgaaaaattc
gctgatcccgaattgaaaaaaggcgttattgaattgattcctatagggtatatcggaaag
ccggaggaagtcgcagcctgcgcggcctggctagcatccgaagaagcaagctatgtgacg
ggcctgacgctgtatgtagacggcgggatgacaaaatacccgggattccaagcgggaaaa
gggtga

DBGET integrated database retrieval system