KEGG   Bacillus licheniformis ATCC 14580: BL01618Help
Entry
BL01618           CDS       T00197                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase (dihydrolipoamide acetyltransferase E2 subunit)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00010  Glycolysis / Gluconeogenesis
bli00020  Citrate cycle (TCA cycle)
bli00620  Pyruvate metabolism
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01120  Microbial metabolism in diverse environments
bli01130  Biosynthesis of antibiotics
bli01200  Carbon metabolism
Module
bli_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL01618 (pdhC)
   00020 Citrate cycle (TCA cycle)
    BL01618 (pdhC)
   00620 Pyruvate metabolism
    BL01618 (pdhC)
Enzymes [BR:bli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BL01618 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_D23 DUF1533 DUF896
Motif
Other DBs
NCBI-ProteinID: AAU23214
UniProt: Q65K42
Position
1635067..1636359
Genome map
AA seq 430 aa AA seqDB search
MAFEFKLPDIGEGIHEGEIVKWFVKPNDEVNEDDVLAEVQNDKAVVEIPSPVKGKVLELK
VEEGTVATVGQTIITFDAPGYEDLQFKGDESGEAKAEEAEKQETDAPAEAAEANEQADAD
PNKRVIAMPSVRKYAREKGVDIVNVSGSGKNGRVLKEDIDSFLNGGTAGDAKAAQAEEKA
EPAAQQPAAAVQVPEGEFPETREKMSGIRKAIAKAMVNSKHTAPHVTLMDEVDVTNLVAH
RKQFKQVAADQGIKLTYLPYVVKALTSALKKYPVLNTSIDDNTDEVIQKHYYNIGIAADT
EKGLLVPVVKNADRKAIFEISNEINELATKAREGKLAPAEMKGASCTITNIGSAGGQWFT
PVINHPEVAILGIGRIAEKAVVRDGEIVAAPVLALSLSFDHRMIDGATAQNALNHIKRLL
NDPQLILMEA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gtggcatttgaatttaaacttccggatatcggggaaggaatccacgaaggcgaaatcgtg
aaatggttcgtcaagccaaacgacgaggtaaacgaagatgacgttttggcagaggtacaa
aacgataaagcagttgtagaaattccttcacctgttaaaggaaaagtattagaattaaaa
gttgaagagggaacagtcgcaaccgttgggcagacgatcatcacatttgatgcaccaggt
tacgaagatcttcaattcaaaggcgacgaatcaggcgaagcgaaagcggaagaagctgaa
aaacaagaaactgatgcacctgcagaagcagcggaagcaaacgagcaagcggatgcagat
ccgaataagcgcgtcattgcaatgccatctgttcgcaagtatgcccgcgaaaaaggcgtt
gatatcgtgaatgtttcaggttccggcaaaaacggccgcgttctgaaagaagatatcgac
agcttcttaaacggaggaactgccggagacgctaaggctgctcaagctgaagagaaagca
gaacctgctgcacagcaacctgcagctgcggttcaagtgcctgaaggcgaattccctgaa
actcgcgagaaaatgagcggaatccgcaaagccattgcaaaagctatggtcaactcaaaa
cataccgctccacacgttacattaatggacgaagtcgatgtgacaaaccttgtcgctcac
cgcaagcagtttaaacaagttgcggctgatcaaggaattaagctgacttacctgccttac
gtggtaaaagctttgacatcagctctgaaaaaatatccagtcctgaatacatcaattgac
gacaatacagatgaagtgattcagaagcactactacaacatcggtattgcggcagacact
gaaaaaggcctgcttgtgccggttgttaaaaatgcggaccgcaaagcgatttttgagatt
tcaaacgaaatcaacgagcttgcgacaaaagcacgcgaaggcaaacttgctcctgctgaa
atgaaaggcgcttcttgcacaattacgaatatcggctctgccggcggtcaatggttcaca
ccggttatcaaccatccggaagttgcgatccttggaatcggccgcatcgctgagaaagct
gtcgttcgtgacggcgaaatcgtcgctgcacctgttctggctctttctctaagctttgac
caccgtatgatcgacggcgcaactgcacaaaacgcgttgaatcacatcaagcgtttgctg
aacgatccacaattaattttaatggaggcgtaa

DBGET integrated database retrieval system