KEGG   Bacillus licheniformis ATCC 14580: BL02431Help
Entry
BL02431           CDS       T00197                                 

Gene name
gtaB
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00040  Pentose and glucuronate interconversions
bli00052  Galactose metabolism
bli00500  Starch and sucrose metabolism
bli00520  Amino sugar and nucleotide sugar metabolism
bli01100  Metabolic pathways
bli01130  Biosynthesis of antibiotics
Module
bli_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BL02431 (gtaB)
   00052 Galactose metabolism
    BL02431 (gtaB)
   00500 Starch and sucrose metabolism
    BL02431 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BL02431 (gtaB)
Enzymes [BR:bli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BL02431 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AAU25256
UniProt: Q65E85
Position
3633662..3634540
Genome map
AA seq 292 aa AA seqDB search
MKKVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIIEEAVEAGIEDIIIVTGKS
KRAIEDHFDFSPELERNLEEKGKIELLEKVKKASNLADIHYIRQKEPKGLGHAVWCARNF
IGDEPFAVLLGDDIVQAEKPGLRQLMDEYEKTLSSVIGVQQVPEDQTHRYGIIDPLTNEG
RLYQVKNFVEKPKPGTAPSNLAILGRYVFTPEIFMYLDKQQIGAGGEIQLTDAIQKLNEI
QRVFAYDFEGKRYDVGEKLGFIQTTLEFAMQDDELKDSLIPFMQDLLAKEEV
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgaagaaagttcgtaaagcgatcattcccgcagcgggccttggaacacgtttcctccct
gcaacgaaagcgatgccaaaggaaatgcttccaatcgtagataagccaaccattcaatat
attattgaagaagccgttgaagccggcattgaagacattatcatcgtaaccggtaaaagc
aaacgagcgattgaagatcatttcgatttctcgccggagctcgaacgcaacctggaggaa
aaagggaaaatcgaactccttgaaaaagtgaaaaaagcgtcaaatctcgctgatatccac
tatattcgccaaaaagaaccaaaaggactcggacatgccgtttggtgcgcccgcaacttt
atcggagacgagccgttcgcagtgctccttggagacgacattgtccaagccgaaaaacct
ggccttcgccagctgatggacgagtacgaaaagactctctcatccgtaatcggcgttcag
caggtgcctgaagaccaaacgcaccgctacgggatcattgatcctttgacaaatgaaggg
cgcctataccaggtcaaaaactttgttgaaaaaccaaaaccgggcacagcaccgtctaac
cttgcgattttgggacgctatgtctttactcctgaaattttcatgtacttagataaacag
caaatcggcgcaggcggagagatccagctgacagatgcgattcagaagttaaacgaaatc
cagcgcgtattcgcttatgacttcgaaggcaaacgctatgacgttggagaaaaactcggt
tttatccagacaactctcgaatttgccatgcaggacgacgaactgaaggattcgctgatt
ccatttatgcaggaccttctggcaaaagaagaagtttaa

DBGET integrated database retrieval system