KEGG   Bacillus licheniformis ATCC 14580: BL02695Help
Entry
BL02695           CDS       T00197                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00220  Arginine biosynthesis
bli00330  Arginine and proline metabolism
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01130  Biosynthesis of antibiotics
bli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BL02695
   00330 Arginine and proline metabolism
    BL02695
Enzymes [BR:bli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BL02695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AAU22178
UniProt: Q65N31
Position
complement(582347..583261)
Genome map
AA seq 304 aa AA seqDB search
MAKKTIRLLMPQWQGGNNPNYSFGAELLAWLAPENDQPLIHVPVQPYDGTPLENENGING
RKQLLEQLEAAQHIIHAHKPDRIVMFGGDCLVEQAPFAYLNERYGGDLGLIWIDAHSDLV
RYAGYDNGHTLPLGNLLGEGDEEFAKHVKIPLKPENVFIAGLAAPTEEETKVISNELQRQ
GIAPTEPDTEVIQRLGIRTAGTKKLMTSTEPIKEWIKESNIKYLAIHLDLDVLDPKAFRS
LLFANPEAPVNFSPEGTMQMPYLLHLLKELSSETDVVGLGITEHLPWDSIHLKKLLSEIP
ILTQ
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaaaacaattcgtctgttaatgccgcaatggcaagggggaaacaatcccaac
tactcttttggagcagaactgcttgcttggctggctcctgaaaatgatcagccccttatt
catgttccggttcaaccttatgatggaactccgcttgaaaacgaaaacgggataaacggg
agaaaacaactgctggaacaattggaggctgctcagcatatcattcatgctcataagccg
gatcgcattgtcatgtttggcggtgactgcttagtcgaacaagcaccatttgcttattta
aacgaacgatacggcggggacttaggtttaatttggattgacgctcatagcgatttagtt
agatatgccggttatgacaacggtcatacattaccgctcgggaatcttttgggagaagga
gatgaagagttcgcaaaacatgtgaaaattcccctgaaacctgaaaatgtctttattgcg
ggattagcagctcctacagaagaagaaacaaaagtgatatcaaatgaacttcaaagacaa
ggtatagctcccacagaaccagacactgaagtgattcaaagacttgggattagaactgcc
ggaactaaaaagttaatgaccagtaccgaacctataaaagaatggataaaagaaagcaac
atcaagtatctggcaatacaccttgatttagacgtgcttgatccgaaggcgtttcgttct
ttattattcgccaatcctgaagcacctgtaaatttttctcctgagggaacaatgcaaatg
ccgtacctgcttcatcttctgaaagaactctcttccgaaacggatgtggttggattaggt
ataaccgagcatttgccgtgggattctattcatttgaagaaattgcttagtgaaatccct
attttaacccaataa

DBGET integrated database retrieval system