KEGG   Bacillus licheniformis ATCC 14580: BL02773Help
Entry
BL02773           CDS       T00197                                 

Gene name
trpC
Definition
(GenBank) indol-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01130  Biosynthesis of antibiotics
bli01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BL02773 (trpC)
Enzymes [BR:bli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BL02773 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AAU23927
UniProt: Q65I33
Position
complement(2344978..2345736)
Genome map
AA seq 252 aa AA seqDB search
MLNQIIDRKREDILKIKLSEDLKLPKRSFKKALLSPNRFVALIAEVKKASPSKGVIQEGF
EPVKIAKQYEQAKADCLSVLTDTPFFQGKNSYLSDVKRSVSLPVLRKDFIIDSIQVEEAD
RIGADAILLIGEALEPQKLFELYQQAVEKGMDVLVEVHGEETLEGILNVFTPEIIGVNNR
NLKNFETTVGQTERMAKLVPPGTVLISESGIGKSEDLTFVKTCGAQAVLVGESLMRETSQ
LKAVYALFGEDG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatcaaattattgatagaaaacgagaagacatcctaaagatcaagctgtcggaa
gatttaaaactgccaaagcggtcatttaaaaaagcgctcctttctccgaaccggtttgtc
gctttaattgcggaggtgaaaaaagcttctccgtcaaaaggcgtgattcaggagggtttt
gagcccgtcaagatcgcaaaacaatacgaacaggctaaagccgattgtttgtctgttctg
acagatacacctttttttcaagggaagaacagttatttgtcagatgtgaaacgctcggtt
tccctgcctgtgctgcgcaaggattttatcattgattccattcaggttgaagaagcggac
cgcatcggagcggatgcgatcctgctgatcggtgaagcgcttgaaccgcaaaagctgttt
gaactctatcagcaagccgttgaaaaaggcatggatgtgctcgtcgaagtacatggcgaa
gagacgcttgagggcattttaaatgtctttacacccgaaatcatcggcgtaaacaatcga
aatctaaaaaactttgaaacgaccgtcggacaaacggagcgaatggcgaaactcgttccg
ccggggaccgttctcatcagcgaaagcggcatcggaaaatcggaagacctgacttttgta
aaaacgtgcggagcccaagccgtgcttgtcggcgaatcgctgatgagagagacgtcacag
ctgaaggctgtctatgcgttattcggagaggacggctga

DBGET integrated database retrieval system