KEGG   Bacillus licheniformis ATCC 14580: BL02818Help
Entry
BL02818           CDS       T00197                                 

Gene name
ydaE
Definition
(GenBank) YdaE
  KO
K09988  D-lyxose ketol-isomerase [EC:5.3.1.15]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BL02818 (ydaE)
Enzymes [BR:bli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.15  D-lyxose ketol-isomerase
     BL02818 (ydaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyx_isomer Cupin_2 ARD Cupin_1 Pkinase
Motif
Other DBs
NCBI-ProteinID: AAU22106
UniProt: Q65N98
Position
517506..518009
Genome map
AA seq 167 aa AA seqDB search
MKVTKEDVIEYYEKAGIVLNDDDKENIQIMDYGLNKLDKLGLQLFVYVNTDRYCAKELVL
FPEQTCPEHRHPPVDKQKGKEETFRCRYGKVYLYVEGEKTEAPAVMPPDEDIEHFTVWHE
IQLTPGEQFTIPPDTKHWFKAGSEGAVVTEFSSTSTDDHDVFTDPRI
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggtgacaaaggaagatgtaattgaatactacgagaaagcgggcattgtgctgaac
gacgatgataaagaaaacatccaaatcatggactacggattaaataagctggataagctg
gggcttcagctgttcgtctatgtcaacacagaccgctactgcgccaaagagctcgtatta
ttccctgaacaaacatgccccgaacaccggcatcctcctgtagacaagcagaaagggaag
gaagagacattcaggtgcagatacggaaaagtgtatttgtatgtagaaggagaaaaaacg
gaagccccggccgttatgccgccggacgaggatattgaacatttcaccgtttggcacgaa
attcagctcacgcccggcgaacagtttacgattccgccggacacgaagcattggttcaaa
gcggggagtgaaggtgcggtggtcacggagttttcttcaacaagcaccgatgatcacgat
gtgttcacagatccgagaatttag

DBGET integrated database retrieval system