KEGG   Bacillus licheniformis ATCC 14580: BL03014Help
Entry
BL03014           CDS       T00197                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00010  Glycolysis / Gluconeogenesis
bli00020  Citrate cycle (TCA cycle)
bli00620  Pyruvate metabolism
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01120  Microbial metabolism in diverse environments
bli01130  Biosynthesis of antibiotics
bli01200  Carbon metabolism
Module
bli_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BL03014 (acoC)
   00020 Citrate cycle (TCA cycle)
    BL03014 (acoC)
   00620 Pyruvate metabolism
    BL03014 (acoC)
Enzymes [BR:bli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     BL03014 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H HlyD_D23 RnfC_N PYNP_C DUF2118
Motif
Other DBs
NCBI-ProteinID: AAU22436
UniProt: Q65MC9
Position
869764..870897
Genome map
AA seq 377 aa AA seqDB search
MAVEVVMPKLGMSMKEGTVSVWNKKVGEAVEKGESIASINSEKIEMEIESPANGTVLDIQ
VSEGEGVPPGTVICRIGNENEQTQESQTKQPDPTKERIKISPAARKIAQSANIDIKTLKG
TGPGGRITKADVLQALPGRPNKQAAKAEAEERPPASPMRKTIAARMTESLQNSAQLTITM
KADITKLTVLQKQLNETAQSRYDTKLTITDFAARAAVFSLLDHPAMNSVYQDGRLATFEH
VHLGVAAALDEGLAVPVIRHAERLPLIELAKKIKWYAKKAREGRLLHDEIEGSTFTITNL
GAYGVEHFTPILNPPETGILGVGQMYSAPVYQDGELTKGAILPLSLTFDHRALDGAPAAA
FLSDVKNYLEDPASILL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaagtggtcatgccgaaattggggatgtcgatgaaagaaggtacggtttcc
gtctggaataaaaaagtcggggaagccgttgaaaaaggagaaagcattgccagcatcaat
tccgaaaaaatcgaaatggaaatcgaatctccggcaaacggaaccgtgttggacatccaa
gtatctgaaggagagggagtgccgccgggaaccgtcatctgccgcatcggaaatgaaaac
gaacaaacgcaggagagccaaacaaaacagccggatcccacgaaagaacggattaaaatt
tctccggctgcgcgcaaaattgcgcaaagcgcaaatatagacatcaaaacgctgaagggc
acaggccccggggggagaattacgaaagcggatgtgttgcaggcgcttcccggccggccg
aacaagcaggcggctaaggctgaagctgaagagcggccgccggcaagcccgatgaggaaa
acgatagccgcaagaatgacggaaagcctgcaaaacagcgcccagctgacgattacgatg
aaggcggacatcacgaaattaacagtcctgcaaaaacagcttaatgaaaccgctcaatca
agatacgatacgaagctgacgatcactgattttgccgccagggcagctgttttttcgctt
ttggatcatccggccatgaacagtgtttatcaagacggaaggcttgcgacctttgagcat
gttcatttaggagtggcggccgctttggacgaaggcctggccgttcccgtcatccgccat
gccgagcggctcccgctgatcgaattggccaagaaaatcaaatggtacgccaaaaaagcg
cgggaaggccggcttctacacgatgaaatagaaggatcgacatttacgattacaaacctc
ggcgcatatggtgtcgagcactttaccccgatcttgaatccgccggaaaccgggatactc
ggagtcggccaaatgtattcggcacccgtttatcaagacggagaactgacaaagggcgcc
attctgccgctcagtctgacttttgatcaccgcgcgcttgatggtgcgcctgctgcagca
ttcctttcagatgtgaaaaactatttggaagatccggcatcaattcttttatag

DBGET integrated database retrieval system