KEGG   Bacillus licheniformis ATCC 14580: BL03887Help
Entry
BL03887           CDS       T00197                                 

Gene name
nfrA1
Definition
(GenBank) FMN-containing NADPH-linked nitro/flavin reductase
  KO
K19285  FMN reductase (NADPH) [EC:1.5.1.38]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00740  Riboflavin metabolism
bli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    BL03887 (nfrA1)
Enzymes [BR:bli01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.38  FMN reductase (NADPH)
     BL03887 (nfrA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AAU25460
UniProt: Q65DM9
Position
complement(3847246..3847995)
Genome map
AA seq 249 aa AA seqDB search
MNKTIETILNHRSIRSFTDRLLTEEEVRLLVESAQSASTSSYIQAYSIIGVTDPDKKRKL
AELAGNQPYVEKNGHLFVFCADLYRHDKIARKKGVDITASLEGTETFMVSVIDAALAAQN
MSIAAESMGLGICYIGGIRNNLNEVSELLETPEYVLPLFGLVVGQPANPSAKKPRLPLDH
IYHENVYQADDAEFEKHLSAYDETISNYYQKRTDGKRSDKWTDQITGSLKKPPRAYMNEF
VKGKGLNKR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaacgattgaaactattttaaatcaccgttcgatcaggtcttttacagatcgg
ctcctgaccgaagaagaggttcgcctgcttgtggagagcgctcaaagcgcatcgacgtca
agctatattcaagcatattcaatcatcggtgtcaccgatccggacaagaagcgcaagctt
gcggaattggccgggaaccagccatatgttgaaaaaaacggccatctgtttgtattttgc
gcagatctttacaggcatgacaaaatcgctcggaaaaagggtgtagatattacagcttct
cttgaagggacggaaacctttatggtcagcgtcatcgatgcagcgcttgccgctcaaaat
atgtcaatagcggccgaatcaatgggcctcggcatctgctatatcggtgggattcgcaac
aatttgaacgaagtctccgagcttcttgaaacacctgaatacgttcttccgctgttcggg
cttgtcgtcggccagccggccaacccttcggccaaaaaaccgcgtctgccgcttgatcac
atttatcatgaaaatgtctatcaagcggatgatgccgagtttgaaaagcatttgtccgca
tatgacgaaacgatttcaaactattatcaaaagcggacggacggcaaacggtctgacaaa
tggacagaccagatcaccggcagcctcaaaaagccgccgcgtgcgtatatgaatgaattc
gttaaaggaaaaggtttgaacaaaaggtaa

DBGET integrated database retrieval system