KEGG   Bacillus licheniformis ATCC 14580: BL03925Help
Entry
BL03925           CDS       T00197                                 

Gene name
mmgA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bli  Bacillus licheniformis ATCC 14580
Pathway
bli00071  Fatty acid degradation
bli00072  Synthesis and degradation of ketone bodies
bli00280  Valine, leucine and isoleucine degradation
bli00310  Lysine degradation
bli00362  Benzoate degradation
bli00380  Tryptophan metabolism
bli00620  Pyruvate metabolism
bli00630  Glyoxylate and dicarboxylate metabolism
bli00640  Propanoate metabolism
bli00650  Butanoate metabolism
bli00900  Terpenoid backbone biosynthesis
bli01100  Metabolic pathways
bli01110  Biosynthesis of secondary metabolites
bli01120  Microbial metabolism in diverse environments
bli01130  Biosynthesis of antibiotics
bli01200  Carbon metabolism
bli01212  Fatty acid metabolism
bli02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BL03925 (mmgA)
   00630 Glyoxylate and dicarboxylate metabolism
    BL03925 (mmgA)
   00640 Propanoate metabolism
    BL03925 (mmgA)
   00650 Butanoate metabolism
    BL03925 (mmgA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BL03925 (mmgA)
   00072 Synthesis and degradation of ketone bodies
    BL03925 (mmgA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BL03925 (mmgA)
   00310 Lysine degradation
    BL03925 (mmgA)
   00380 Tryptophan metabolism
    BL03925 (mmgA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BL03925 (mmgA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BL03925 (mmgA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BL03925 (mmgA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bli04147]
    BL03925 (mmgA)
Enzymes [BR:bli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BL03925 (mmgA)
Exosome [BR:bli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BL03925 (mmgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt FAE1_CUT1_RppA ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AAU25407
UniProt: Q65DT2
Position
complement(3793485..3794663)
Genome map
AA seq 392 aa AA seqDB search
MARSVIAGGARTPFGKLGGALQSKTAAELGGIAVKEALKRSGVNPEDVDEVIMGSVLQGG
QGQLPSRQAARFAGLPWDVKTETINKVCASGLRSVTMADQIIRAGDAEVIAAGGMESMSN
APYLLQKARWGLRMGDGAVKDLMIADGLTCSFTGVHMGSYGNAAAKELEIAREEQDRWAL
RSHMRAVHAADSGALGEEIVPVSIQEKRDGELTVDQDEAPRRDTSMERLSKLAPVFDHNG
TITAGNAPGVNDGACSLIVMNEDKAKELNVKAPAVIKAHTSIAVEAKDFPKTPGLVIREL
LNKTGAELSDIKLFEINEAFAAVALASGKIAGLDMEKVNVNGGAIAIGHPIGASGARIIL
TLMYELKRRGGGIGIAAICSGGGQGDAVMIEV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
gtggcgagatcagttattgcaggcggcgcacgcacgccttttggaaaactcgggggcgcg
cttcagtcaaagacggctgcggagctcggcggaatcgccgtaaaagaggcattaaaacgt
tccggtgtaaatcctgaggatgtcgatgaagtcatcatgggctccgtacttcaaggcgga
caggggcagctgccgtcgaggcaggccgcgcgttttgcgggactcccgtgggacgtcaaa
acggaaacgattaataaagtgtgcgcttcaggtttaagaagcgtcacaatggcggatcag
atcatcagggccggtgatgcggaggtcattgccgccggaggtatggaatcgatgtcaaac
gccccttatttgcttcaaaaagcgaggtgggggctgaggatgggagacggggcggttaaa
gatttgatgatcgcagacgggctgacatgctcatttacgggcgttcacatgggctcctac
ggaaatgccgctgcgaaagagttggagattgctagggaagagcaggatcggtgggcgctc
aggagccacatgcgagccgtacacgctgcggattcaggcgcgctaggagaagagatcgtc
ccggtcagcatccaagagaagcgggacggcgaattaacggtcgatcaagatgaagcaccg
cggcgcgacacgtcaatggaaaggctgtcaaagcttgccccggtttttgaccataatggg
acaattacggcgggaaacgcgccgggggtaaatgatggggcatgctcacttatcgtgatg
aatgaagacaaggcaaaggaactcaatgtgaaggcgccggccgtcattaaagcgcacaca
tcaattgcagtcgaagcaaaagactttccgaaaacccccgggcttgtcatcagagaactg
cttaacaaaacgggagctgagctttctgatatcaaactgtttgaaatcaatgaagctttc
gctgcggttgctttggcaagcggaaagatcgcgggtcttgacatggagaaggtcaatgtc
aacggcggcgccattgcgatcggccatccgatcggcgcgagcggagcaagaatcatttta
acgcttatgtacgaattaaaacggcgcggcggcggtatagggattgctgccatttgcagc
ggcggcggccagggagacgccgtgatgatcgaggtataa

DBGET integrated database retrieval system