KEGG   Bacillus licheniformis ATCC 14580: BL03942Help
Entry
BL03942           CDS       T00197                                 

Gene name
xylR
Definition
(GenBank) transcriptional regulator XylR
Organism
bli  Bacillus licheniformis ATCC 14580
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK HTH_24 TrmB SMC_ScpB MarR DUF3618 UPF0223
Motif
Other DBs
NCBI-ProteinID: AAU25490
UniProt: Q65DK2
Position
3876248..3877411
Genome map
AA seq 387 aa AA seqDB search
MNTADQALVKKMNKALIFEQIIENGPVSRAKLSEITGLNKATVSSQVSSLLQKDIIYETG
PGESSGGRRPVMLKFNRKAGYAVGVDVGTNYIIVALTDLEGHLIEQFERTLDEEDIQATE
EALIELTGLAVDKIPPSPFGLTGIGVCVPGLVDNERHVVFTPNKPIHLIPIKEKLEERFG
VPILIENEANAGAVGEKEYGEGGQLEHAVFVSINTGIGLGILMNGKLFRGVQGFSGEAGH
MSIHFDGPLCRCGNRGCWELYASEKAVFSHYAANSGAQLYETVKELADRGDPGMMETFER
FGFHIGIGLLNILKTLNPDTIILRNTIVESYPSIVDAIKKTIASRSAAEALSNYHLKIST
LGRTASALGMSSLVTERFLERFMNERF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttgaatacagcggatcaagcccttgtaaaaaaaatgaacaaagccctgatttttgagcag
attattgaaaacggacccgtctcaagggccaaactttcggaaataacaggattaaataaa
gcgaccgtttcctcccaagtgtcttccctgcttcaaaaggacatcatttatgaaaccggc
cccggcgagtcaagcggcggcagaaggcccgttatgctgaaattcaatcgaaaagccggc
tatgcggtcggtgtagatgtcggaaccaattatataattgttgcgttaaccgaccttgaa
gggcatttgattgaacaattcgaacgaacgcttgatgaagaagacattcaggcgacagaa
gaggcattaatcgaattgacggggcttgccgttgacaaaataccgccttccccattcgga
ttgaccggaatcggcgtgtgcgtgcccggcttggtggacaacgaacggcatgtagtcttt
acgccaaataagccgatccatttgattccgataaaagaaaaactggaagaaaggttcggc
gttcccattttaattgaaaacgaagccaacgccggcgccgttggcgagaaggaatacggg
gaaggcggccagcttgagcatgccgtgtttgtcagcattaataccgggatcggtttaggg
attttaatgaatggaaaattgtttagaggtgtgcaaggtttttccggagaagccgggcac
atgtccattcactttgacggtccgttatgccggtgcggaaatagaggctgctgggagctt
tacgcttcagaaaaagccgtcttctctcactatgcagcgaattccggggcccagctttac
gaaaccgttaaagaacttgcagaccgcggtgatccgggcatgatggagacgtttgaacgc
tttggctttcatatcggcatcgggcttctcaacatcttgaaaacgttgaatcccgacacc
attatcttgcggaataccatagtggaatcctatccgagcatcgtcgatgcgatcaaaaaa
acgattgcctcaagaagcgcagcagaagccttgtctaattatcatttaaaaatctccacg
ctcggccgcaccgcctcagcgcttgggatgtcctcccttgtaaccgaacgttttctggaa
cggtttatgaacgagagattttaa

DBGET integrated database retrieval system