KEGG   Brevibacterium aurantiacum: BLSMQ_0631Help
Entry
BLSMQ_0631        CDS       T04775                                 

Definition
(GenBank) N-hydroxyarylamine O-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
blin  Brevibacterium aurantiacum
Pathway
blin00232  Caffeine metabolism
blin01100  Metabolic pathways
blin01110  Biosynthesis of secondary metabolites
blin01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:blin00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    BLSMQ_0631
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    BLSMQ_0631
Enzymes [BR:blin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     BLSMQ_0631
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: AOP52345
UniProt: A0A1D7W005
Position
680616..681530
Genome map
AA seq 304 aa AA seqDB search
MTHASLLSRYAKRLVLSDSVPELRRRAQGSYAQIVDLLDEILVAHTHAICFENLDVTAFR
ARGDLKAVAIDVDGAADKLLTDGRGGYCHEHAALIRGVVTELGLRAHPILARVHLGDGQT
APGALTHQATIVDLDGRRLLIDPGFGGGTPEAALELSESAAARMTSHGEHRIVPARTALT
PHLRADSDWVLQSRTRDEQDFRTVYAFSEVPRPQADLDLANWFTSTKPGARFTGPPILAL
PLPDGGRVTLEGRRLRRMIGGVRPDRHERTLSDATEFAEVLSTEFGLDLDREFTDLVWSA
TAEG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgactcatgcatcgcttctcagccgttatgcgaaacggctcgtgctcagtgattccgtc
cccgagcttcgccgacgcgcgcagggatcgtatgcgcagattgtcgacctactcgacgaa
atcctggtcgcgcacacgcacgcgatctgctttgagaatctcgatgtcaccgcctttcgc
gccaggggtgacctcaaggccgtcgcgatcgacgtcgacggagccgcggacaaactgctc
accgacggccggggcggatactgccacgaacatgccgcactcatccgcggggtcgtcacc
gaactggggctgagggcacacccgattctggcccgagtccacctcggcgacgggcagacg
gcaccgggagcactgactcaccaggcgaccatcgtcgacctcgacggccgtcgtttactc
attgatcccggcttcggcgggggaacaccggaagctgcgctcgaactctccgaatccgct
gcggccagaatgacgtcccacggcgaacaccgaatcgtccccgcgaggactgctctcacg
cctcatctgcgcgccgacagcgactgggtgctccaatcacgaacgcgagatgaacaggac
tttcgcaccgtctatgcgttcagcgaagtccctcgcccgcaggccgatctcgacctggcg
aactggttcacctcgactaaacccggggcgcggttcaccggtccgcccattctcgctctg
ccgctccctgacggcggcagggtcactttggaggggcgccgactgcggcgcatgatcggc
ggtgtgcgacccgaccgacacgaacggaccctgtctgatgccacggaattcgccgaggtg
ctgtcgactgaattcggactcgacctcgacagggaattcactgacctggtgtggagcgcg
accgctgaggggtga

DBGET integrated database retrieval system