KEGG   Brevibacterium aurantiacum: BLSMQ_1383Help
Entry
BLSMQ_1383        CDS       T04775                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase, R-alcohol forming, (R)- and (S)-acetoin-specific
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
blin  Brevibacterium aurantiacum
Pathway
blin00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:blin00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BLSMQ_1383
Enzymes [BR:blin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BLSMQ_1383
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BLSMQ_1383
    1.1.1.-  
     BLSMQ_1383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAD_binding_3 AlaDh_PNT_C ADH_zinc_N_2 adh_short
Motif
Other DBs
NCBI-ProteinID: AOP53093
UniProt: A0A1D7W253
Position
complement(1492826..1493887)
Genome map
AA seq 353 aa AA seqDB search
MKAARFYDRNDIRIEDIPEPELKPGTVAIDVAWCGICGTDLHEYLEGPIFVPPEGHPHPI
SGESAPVTMGHEFSGTITSLGEGVSDLEVGQNVVVEPYIIGDDVDTSIGQSYQLSQDMNF
IGLGGGGGGLSEKIVVQRRWVHPIGEIPLDQAALIEPLSVAHHAVVRSGAKSGQVAIVGG
AGPIGLLTAAVLKAEGLTVFISELSEARKKMALSTGVADEVLDPREGDVAETVRQRTNGQ
GADVGFECSSVPVVLDMLLDAVRPGAVIVNVSIWGHKPEVDMPKLVLKEIDLRGTIGYSG
DHPSTIELVRSGKIDLSSFITGRIGLDELVTGGFDELINNNEQHVKIIVDPRA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagcacgattctatgatcgcaatgacatccgaatcgaagacattcccgagccc
gagctgaagcccggaactgtcgcaatcgacgtagcgtggtgcggaatctgcgggaccgac
ctgcacgagtacctcgaaggcccgatcttcgtcccaccagagggacacccgcatccgatt
tcgggtgaatccgcaccggtgactatgggccacgaattctcgggaaccatcaccagcctc
ggcgagggtgtctctgatcttgaagtgggacagaacgtcgtcgtcgagccctacatcatc
ggcgatgatgtcgatacgagcatcgggcagagttatcagctctcgcaggacatgaacttc
atcgggctcggtggtggtggcggtggcctatcggagaagatcgtcgttcagcggcggtgg
gtccatccgatcggtgagatcccactcgatcaggcggcgctcatcgaaccgctctccgtc
gcccaccatgcagtcgtccgctccggcgcgaagtctggtcaggtcgccatcgtcggcggg
gcgggccccatcgggttgctcaccgctgccgtgctcaaggcggagggcctcaccgtcttc
atctccgagctttccgaggcgaggaagaagatggcgctctcaaccggagttgccgacgaa
gtcctggatccacgagaaggcgacgttgccgaaacggtccgtcaacgcacaaacggccag
ggcgcagacgtcgggttcgagtgttcatctgtgccggtggtactcgacatgctgctcgac
gcggttcgtccgggagcagtgatcgtcaacgtctccatctggggccacaagcctgaagtc
gatatgccgaagcttgtgctcaaggagatcgatctgagaggaacgatcgggtattcggga
gaccatccgtccacgatcgaactcgtccgcagcgggaagatcgacctctcctccttcatc
accgggcgcattgggctcgatgagttggttacgggcggcttcgacgagctcatcaataac
aacgagcagcatgtgaagatcatcgtcgatcctcgagcctga

DBGET integrated database retrieval system