KEGG   Brevibacterium aurantiacum: BLSMQ_2193Help
Entry
BLSMQ_2193        CDS       T04775                                 

Definition
(GenBank) Phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
blin  Brevibacterium aurantiacum
Pathway
blin00770  Pantothenate and CoA biosynthesis
blin01100  Metabolic pathways
Module
blin_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:blin00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BLSMQ_2193
Enzymes [BR:blin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     BLSMQ_2193
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     BLSMQ_2193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: AOP53899
UniProt: A0A1D7W4C6
Position
complement(2370276..2371523)
Genome map
AA seq 415 aa AA seqDB search
MRTVLGVAGGIAAYKACHVIRRLRELGHSVKVVPTASALNFVGAATFEALSSQTVTTDVF
DEVESVNHVRIGQDAELVVIAPATANTLAKLAAGIADDLLTATVLTTTAEVVVAPAMHTE
MWQNAATVANIATLKQRGIHVLEPAVGRLTGPDSGPGRLPEPEAIVDFALAAAANAAAAK
LGGPLQGKHLVVSAGGTREPLDPVRFLGNRSSGKQGIALARAAAAAGAEVDLVAANIDTG
LLSGLPDNVRITNVESTLELQTQMLASQPEADAIIMAAAVADYRPAQRTDSKMKKSGGDG
LTLSLVQNPDVLVGLVQSRPESQIIVGFAAETGDSHHSALDYAKAKFRRKGVDLLVFNNV
SEDRAFGHDDNAVQILSADGTDVDASVEFHGSKDDVSEKVIAALVNRMECVESTP
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtgagaaccgtactcggcgtcgccggtggaatcgctgcctacaaggcgtgccatgtcatt
cggcggctccgggagctcgggcacagcgtcaaggtcgtgcccactgccagcgcgctgaac
ttcgtcggtgctgccaccttcgaggcgttgtcctcgcagacggtgaccaccgacgtcttc
gacgaggtcgagtcggtcaaccatgtccgcatcgggcaggatgccgaactcgtcgtcatt
gcgccggccacagccaataccctggccaaactggccgcaggaatcgccgatgatctgctc
accgcgacggtcctgacgacgaccgccgaggtggtcgtcgctccggccatgcacaccgag
atgtggcagaacgctgccaccgtcgccaacattgcgaccttgaagcagcgaggcatccat
gtcctcgagcccgctgtgggacgactcaccggacccgactccggtcccgggcgcctgccc
gaacccgaggcgatcgttgatttcgcccttgccgccgctgcgaacgctgcggccgccaag
ctcggcggaccgctgcagggcaagcaccttgtcgtcagtgccggcggaacccgagaacca
ctcgatcccgtgagattcctcggcaaccgctcgtcaggcaagcagggcatcgcgctggca
cgagccgccgcagcagccggcgccgaagtggatctggttgctgccaacatcgacacggga
ctgctgtccggcctgccggacaacgtgcgcatcacgaacgtcgaatccacgctcgaactc
cagacccagatgctcgcctctcaacccgaggccgatgccatcatcatggccgcagccgtc
gccgactaccggccggcacagcgcaccgattcgaagatgaagaagtccggtggcgatggt
ctgaccctcagcctggtgcagaaccccgatgtgctcgtcgggctcgtgcagtcacgcccc
gagtcgcagatcatcgtcggattcgccgccgagaccggagattctcatcacagtgcgctc
gactacgccaaggcgaagttccggcgcaagggtgtcgacctcctggtcttcaacaatgtc
tccgaggacagagccttcggccacgatgacaacgccgtccagatcctcagcgctgacggc
actgacgtcgacgcatccgtggaattccacggcagcaaggacgatgtttcggaaaaggtc
atcgcggctctcgtgaatcgaatggaatgcgtagaatcgacgccgtga

DBGET integrated database retrieval system