KEGG   Bifidobacterium longum DJO10A: BLD_0060Help
Entry
BLD_0060          CDS       T00707                                 

Definition
(GenBank) Transcriptional regulator
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
blj00010  Glycolysis / Gluconeogenesis
blj00520  Amino sugar and nucleotide sugar metabolism
blj01100  Metabolic pathways
blj01110  Biosynthesis of secondary metabolites
blj01120  Microbial metabolism in diverse environments
blj01130  Biosynthesis of antibiotics
blj01200  Carbon metabolism
Module
blj_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:blj00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLD_0060
   00520 Amino sugar and nucleotide sugar metabolism
    BLD_0060
Enzymes [BR:blj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     BLD_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ACD97506
UniProt: B3DPR2
Position
73403..74170
Genome map
AA seq 255 aa AA seqDB search
MIETAQAFGVDIGGSGIKAAPVDLTKGDFAEPRLKILTPEVSTPQAVAKIVKQQLDHFEV
PESAPVGIAFPAPIKPGQKLDFMANLDQSWIGVDVTEVFSEACGRPVVVVNDADAAGLAE
VQFGAAKGQDGLVIATTLGTGIGTALIYNGVLIPNTELGHIILSAKHLDAEKYASSAIRE
NEELGYKKWAKRLTKYYGLMEKYFNPDLFTVGGGVSRQSDKFLPYVDIKTPIVPAKLRNQ
AGIVGAAYYASTKQQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaactgcacaggctttcggtgttgacattggcggttccggcatcaaggccgca
cccgtcgatctgaccaagggcgatttcgccgagccacgattgaagattctcactcccgag
gtctccactcctcaggccgtggccaaaatcgtcaagcagcagctcgaccacttcgaagtg
cctgaatccgcacccgttggcatcgctttccccgcgccgatcaagcccggccagaagctc
gacttcatggccaaccttgaccagtcttggattggcgtggacgttactgaagtgttctcc
gaagcctgcggccgcccggtcgtcgtggtaaacgacgccgacgccgccggcctggccgaa
gtccagttcggtgccgccaagggccaggatggtctggtcatcgccaccacactgggcacc
ggcatcggcaccgccttgatttacaacggcgtgctcatcccgaacaccgaactcggacac
atcatcctgagcgccaagcatctggacgccgagaagtatgcctcctccgcgattcgcgag
aacgaggaactgggctacaagaagtgggccaagcgtctgaccaagtactacggccttatg
gaaaagtacttcaacccggacctgtttaccgtcggcggcggcgtgagccgtcagagcgat
aagttcctgccgtacgtggatatcaagaccccgattgtgcccgccaagctgcgtaaccag
gctggcatcgtcggtgccgcctactacgccagcaccaagcagcagtga

DBGET integrated database retrieval system