KEGG   Bifidobacterium longum DJO10A: BLD_0535Help
Entry
BLD_0535          CDS       T00707                                 

Gene name
glnE
Definition
(GenBank) Glutamine synthetase adenylyltransferase
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
blj  Bifidobacterium longum DJO10A
Brite
KEGG Orthology (KO) [BR:blj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BLD_0535 (glnE)
Enzymes [BR:blj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     BLD_0535 (glnE)
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     BLD_0535 (glnE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294
Motif
Other DBs
NCBI-ProteinID: ACD97981
UniProt: B3DS62
Position
complement(611533..614763)
Genome map
AA seq 1076 aa AA seqDB search
MESSIFKPSSMDLIRAGLQDLDKARALFDQLKADDIPDERCAELLSALAHACDPDMALSN
FVDIVNAMQSSQRDLEHVIPDNDALKRLVTVLGVSDAMGKFMRFKPQLVEAAAVDNCNSH
LFNHAQRRARLLKAVGADPDEPAMPVASKDLAEAATALRSSYRNQLAAIIAQDAVADDPT
SIQPTISRELSDLADAALEGALAIARHETEGSEHVRFTIIGMGKLGAQELNYVSDVDLIY
VVEPADKDVDHQTLIRVGTKMGTMLQRVCQSAIMGVAEQPLWQIDGGLRPEGKDGALVRV
LSSHKNYYEQWAENWEFQALLKARPVAGDPDLGQAYMDMTRPFVWSASKRKNFVYDCQKM
RKRVEDLIPAPLKDREIKLGRGGLRDVEFTVQMLQLVHGRTDESLRTSNTLDSLQRLSEG
GYVSRKQAVRMSQDYRFERVMEHRQQIWSLKRTHLFPDLGRASVGGLEKKRDIDVDELNQ
NQELRRLARAFGLHPEELVDKYDDTRREVRHLHLDIYYRPMLPVNAQMENDQIVLSVEAA
QERFESIGFGDPDAAIRHVQALTAGVGRAAKINRIILPAVLQWLGEGQNPDMGLLNWRKL
EENFGTESGYLGFLRDSTSAAQRLCHILSNSRFLGDALNKSVESISWLGDDDNLQARTRE
ALDVQTGSALERFGSNINEFATSMRAMRRHEIERIGLSWMSGVISDSDSLKAMTDVYDAI
IDASLTWAVRHQIAEFGVETAPAGITVIAMGRYGGREVNFSSDADAILIYRPADDADDGQ
ANAFAKKVVEDLRNILQGPTTLEPKIELDLDLRPEGKNGPLVRSYASCEEYYESWASTWE
RQALLRARYAAGDAELARDFLINIADPLRYPTTELTEAELQNIRKLKARMEAERLPRGVR
RERHLKLGKGGLSDVEWTVQLMQLQHAGDIKDLRVNGTLEALDVLEAKKLISAIDAIQLR
KAWTLCTAARNGSYLWSGRANQADILPDDIYSLGGIAVYLGYGAHRGQHFENDLLAVMRK
CRDVCQRLFYGKTEGEAAAATTATASAATQQPQTAPRPRMHVIAPRLERNRRRAQR
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgtcgatcttcaaacccagctccatggacctcatcagggcaggtctgcaagac
ctcgacaaggcccgcgccttgttcgaccagctcaaggcggacgacattcccgatgagcga
tgcgccgaactgctgagcgcgctggcccacgcctgcgatcccgatatggcattgagcaat
ttcgtggatatcgtcaacgcgatgcaatccagccagcgcgatctggaacacgtcatcccc
gacaacgacgccctgaagcgtctggtcacggtgctcggcgtctccgacgcgatgggcaag
ttcatgcgcttcaagccgcagcttgtggaggcggcagcagtcgacaactgcaacagccat
ctgttcaatcacgcgcaacgccgtgcacgtctgctcaaggcggtcggcgcggacccggac
gaaccggccatgcccgtcgcctccaaggatctggccgaagcggccacggccctgcgttcc
agctaccggaaccaactggccgccatcatcgcccaggatgccgtggcggacgacccgacc
tccatccaaccgaccatcagccgcgaactgtccgacctcgcggacgcggcgctcgaaggc
gcgctggccatcgcccgccacgaaaccgagggcagcgagcacgtgcgcttcaccatcatc
ggcatgggcaaactcggcgcacaggaactgaactacgtctccgacgtggacctcatctac
gtggtcgaaccggccgacaaggatgtggaccatcagacgctgattcgcgtgggcaccaag
atgggcaccatgttacagcgcgtctgccagtccgccatcatgggcgtggccgagcagccg
ctgtggcagatcgacggcggcctgcgcccggaaggcaaggacggcgcgctggtgcgcgtg
ctctcctcgcacaagaactattacgagcagtgggccgagaattgggagttccaagcgctg
ctcaaggcccgcccggtggccggcgaccccgacctcggtcaggcctacatggacatgacc
cggccgttcgtgtggagcgcatccaagcgcaagaacttcgtctacgactgccagaaaatg
cgcaagcgcgtggaggatttgattcccgcgcccctgaaggaccgcgagattaagctcggc
cgcggcggtctgcgcgatgtggaattcaccgtgcagatgctccagctcgtacacggccgc
accgacgaatcgctgcgcaccagcaacacgctcgactcgctgcagcgcctgtccgaaggc
ggctatgtctcgcgcaagcaggccgtgcgcatgtcccaggactaccgcttcgagcgcgtg
atggaacatcgccagcagatctggtccctgaagcgcacgcacctgttcccggacctcggc
cgggcctcggtcggaggcctcgaaaagaagcgcgacatcgacgtggacgagctcaaccag
aaccaggagctgcgccgactcgcccgcgcattcggcctgcacccggaagaactcgtcgac
aagtacgacgacacccgccgcgaagtacgccacctgcacctcgacatctactatcgcccg
atgctgccggtcaacgcccagatggagaacgaccagatcgtcctgagcgtcgaggcagca
caggaacgattcgaatccatcggtttcggcgacccggacgccgccatccgccacgtgcag
gcgctcaccgccggcgtggggcgcgcggccaaaatcaaccgcatcattctgcccgccgtc
ttgcagtggctgggcgagggccagaacccggacatgggcctgctcaactggcgcaaactg
gaggagaacttcggcaccgaatccggctacctcggcttcctgcgcgactccacctccgcc
gcccagcgcctgtgccacatcctgtccaactcacgattcctgggcgacgcgctcaacaag
tcggtcgaatcgatcagctggcttggcgacgacgacaatctgcaggcccgcacgcgcgag
gccttggacgtgcagaccggctcggcgctggaacgtttcggctcgaacatcaacgagttc
gccacctccatgcgcgccatgcgccgccacgaaatcgaacgcatcggcctgtcttggatg
agcggtgtgatcagcgactccgacagtctcaaggccatgaccgacgtgtatgacgcgatc
atcgatgcctccctgacctgggccgtgcgccaccagatcgccgagttcggcgtcgaaacc
gcgccggccggcatcaccgtcatcgccatgggccgttacggcgggcgcgaagtgaacttc
agctccgatgcggatgccattctcatctaccgtccggccgacgatgccgacgacggccaa
gccaacgccttcgccaagaaggtcgtggaagacctgcgcaacatcctgcaaggaccgacg
acgctggaacccaagatcgaactcgacctggacctgcgcccggaaggcaagaacggcccg
ctcgtgcgctcctatgcctcctgcgaggaatactacgaatcctgggcttcgacctgggag
cgccaggcgctgctgcgcgcccggtacgcggccggcgacgctgaactggcgcgggacttc
ctgatcaacatcgccgacccgctgcgctacccgaccacggaactgactgaagcagaattg
cagaacatccgcaagctcaaggcccgcatggaagccgagcgtctgccgcgcggcgtgcgc
cgtgaacggcatctgaagctcggcaagggcggcttgtctgacgtggaatggaccgtgcaa
ctcatgcagctccagcacgccggcgatatcaaagatctgcgcgtcaacggcacgctggag
gcattggacgtgctggaagccaagaagctcatcagcgctatcgacgcgattcagctgcgc
aaggcatggacgttgtgcaccgcggcccgcaacggcagctatctgtggagcgggcgcgcc
aaccaggccgatattctgcctgatgacatctattcgctgggcggcatcgccgtctacctc
ggctacggcgcccaccgcggccagcatttcgagaacgacctgctggccgtgatgcgcaaa
tgccgtgacgtatgccagcgcttgttctatgggaagaccgaaggcgaggcggctgcggca
accaccgccacggcctccgccgcaacgcagcagccgcaaaccgcccctcgcccgcgtatg
cacgtgatcgcaccgcgactggaacgaaatcgacgccgcgcgcagcgataa

DBGET integrated database retrieval system