KEGG   Bifidobacterium longum DJO10A: BLD_0857Help
Entry
BLD_0857          CDS       T00707                                 

Gene name
gly1
Definition
(GenBank) Threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
blj  Bifidobacterium longum DJO10A
Pathway
blj00260  Glycine, serine and threonine metabolism
blj01100  Metabolic pathways
blj01110  Biosynthesis of secondary metabolites
blj01120  Microbial metabolism in diverse environments
blj01130  Biosynthesis of antibiotics
blj01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:blj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLD_0857 (gly1)
Enzymes [BR:blj01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BLD_0857 (gly1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ACD98303
UniProt: B3DT34
Position
980350..981375
Genome map
AA seq 341 aa AA seqDB search
MLSFENDYSRAAHPAVLEAVAEANNHLYSGYGSDELSDQAKAKIREACGQPDADVWFLVG
GTQTNQVVIDTITPAYAGVVAVASGHPNVHEAGAIEFSGHKVLTIPQHNGKMDPTELDEF
CKTFYADGNYEHMVFPGSVYVSQSTEYGTIYSKAELQAIADVAHKYDMPLFVDGARLGYA
LTTTGSDMTLADLATIADVFYIGGTKVGALFGEAVVFTKHNTPKHFLTLIKQHGALLAKG
FVLGAQFDALFTDNLYFKIARNANEAADRIREALRAKGYTLTFEAPTNQIFVTMDQPTID
RLEREIKLGFTEKADDTHTVMRICTSWATTPEEVDQLIELL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcttttgagaacgattactcccgcgccgcccatcccgcggtgcttgaagccgtg
gctgaagccaacaaccatctgtattcgggctacgggtccgacgaactgagcgatcaggcc
aaggccaagatccgcgaggcctgcggccagccggacgcggatgtgtggttcctcgtcggc
ggcacgcagaccaaccaggtcgtcatcgacaccatcaccccggcgtatgcaggcgtggtc
gcggtcgcctccggccatccgaacgtgcacgaggccggcgccatcgagttctccgggcac
aaggtgctcacgattccccagcacaacggcaaaatggacccgaccgaactggacgagttc
tgcaagaccttctatgcggacggcaactacgagcacatggtgttcccgggctccgtgtac
gtctcgcaaagcaccgaatatggcaccatctactccaaggccgagttgcaggccatcgcc
gatgtggcgcacaagtacgacatgccgctgttcgtggacggagcgcgactcggctacgcg
ctgaccaccaccggctcagacatgacgctcgcggatctggcgaccatcgccgacgtgttc
tacatcggcggtaccaaggtgggtgccctgttcggcgaggccgtggtgtttaccaagcac
aacacgccgaagcacttcttgaccctcatcaagcagcacggtgccttgctggccaagggc
tttgtgctgggcgcgcagtttgacgctttgttcaccgacaacctgtatttcaagatcgcc
cgcaacgccaatgaggcggccgatcgtattcgcgaggccctgcgcgccaagggctacacg
ctcactttcgaagcgcccaccaaccagattttcgtgacgatggatcagccgaccatcgac
cgtctggagcgcgagatcaagctcggctttaccgaaaaggccgacgacacgcacaccgtg
atgcgcatctgcaccagctgggccaccacgcctgaagaggtcgatcaacttattgagttg
ttgtaa

DBGET integrated database retrieval system