KEGG   Bifidobacterium longum DJO10A: BLD_1519
Entry
BLD_1519          CDS       T00707                                 

Definition
(GenBank) Hypothetical protein
  KO
K24100  galactan exo-1,6-beta-galactobiohydrolase (non-reducing end) [EC:3.2.1.213]
Organism
blj  Bifidobacterium longum DJO10A
Brite
KEGG Orthology (KO) [BR:blj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BLD_1519
Enzymes [BR:blj01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.213  galactan exo-1,6-beta-galactobiohydrolase (non-reducing end)
     BLD_1519
SSDB
Motif
Pfam: Big_3 F5_F8_type_C RicinB_lectin_2 Big_4 Cadherin-like DUF5344 UPF0176_N
Other DBs
NCBI-ProteinID: ACD98964
UniProt: B3DPA5
Position
1791559..1796100
AA seq 1513 aa
MKVLSKSLAAMVAAATLVGGGAFAVAGTAYAADNDAITVTPNPWYANSFDGWGTSLAWFA
NATGSLGEESAITTNLGDDASKAKAVEYGKQLREQFYQSIFGDEGLDLNMARYNVGGGNA
SDVAYGYPFMRQGAAVPGTWKDDATGSGTYGNGVTTKQADKDKLAAAFDPTDDNQYDFSK
SAAQDWWIERGATGDNPDITDVEAFANSAPWFLTNSGYATGGRNSGSNNLANPEKFAQYM
AKNVEHLESLGANVDTVEPFNESETSYWGTPGDMASKYTDESDDNTKLINNYWDKYYSDK
DRSVTPYSNALKKPQEGMHVSNAQQQQTITALAEALKDNDDTTIAATDATNSADFVKSYN
QYPQAIKDLIGQYNVHAYSDSNQMQSRDIAQADGKKLSMSEVDGSWQSGSYNPYGFDNAL
GMMSKISSNVTRLQSKDFTFWQVVEDLYNMQMGSNVNPAGENTNWGTVLIDFDCTVAGMD
GKLYSERRVNNNGGTTDGLEPCTVIANAKYNGVKAITHFIHAGDKVIANNDEDNNMTATS
DDGKTQTVIHRNSGTSDQTFVIDLSKYGEIADNAYGELYLTTETSAEDKNAGVDSATPEV
FAKTSNVKQAEGSVMIDKAAKTATVTVPARSIASIQLTGVTGYAKDAAVETGDTYQLVGK
QSGKAVADTTSGDSALSLANVASDAENAKKQTWTFTQIEQPADSERPDLKAYVITNAEGK
VLVSKDGTNALSNETVEAAKSDPAAKWILNTSDGSTYQLLNAATKTNLDVDNSGTTVGTK
VGLWQSPSGTSPSANQTWTLRNVTPTSQKTVNVQTAVNEKAALPTEVTLYYTWGEGKATV
ANWDTSKVDVAKEGTYEATATATDVYGNEFNVAATVYVGALTVSDPVSATVLAGTSASEA
KAALEAAPVYLHVKASPAFEGDAAKVTWNFDGLDTKLADAKAGDNIAVTGTYQLDDATTI
ALKGTIYVTAATPENVADTASSLTVTNQQTEYSKGDQWKKLTDGDTSAEAWVTWNSAGDY
SASPTATIDFGSECELSSVTITYGDKAPASAKAEYTTDGETWMQFGSDVKPAAGQTVTFK
ADKGTVNATKVRIVNTVNNDYMNATEIQAFVTPVQGAAKNIAAASGTNFSVNFQEGASAS
KAIDGDTTSKGWSTWASTASTVDPVATFTFDEAQTITEVKTFFYYDGRASWPKSQTLEYQ
NEAGEWHGVGTKDGWKIQAGDAGSGSDGITAADTPTVDFVLGTPVKAKAIRLTNTLQDTK
VYINVAEIQVFAQDSTVLTPQPASDATLGDLRLDGETVEGFDPSKTDYTVDLPVDAEANP
VLQAFATDNAAAVKVTGDAVENGKLGGKAAITVTSADESETKTYTVTFNAFTLASLKVIG
PTKTEYAIGDKLDTAGLKVTAVYQSVDKTKEVPVALDDPQLAIGSFDSTTAGKKAITVSY
RGVTATFNVTVKANAVAPGPEEQKPGNTNKPGATGNGNKNTVANTGSSVAAIAGAVALLA
AAAGALFMLRKRA
NT seq 4542 nt   +upstreamnt  +downstreamnt
atgaaggtactgagcaaatcgcttgctgcaatggttgcggcggcaacactagtgggagga
ggggcgtttgcggttgccggcactgcgtatgcggctgataacgatgccattaccgtgacc
ccgaacccgtggtatgccaacagtttcgatggctggggcacctcactggcttggttcgcc
aacgccaccggcagcctcggcgaggaatcggccatcaccaccaatctcggcgatgacgct
tccaaggctaaggctgtggaatacggtaaacagctgcgcgaacagttctaccagtccatc
ttcggtgatgaaggactggacctgaacatggcccgctacaacgtgggcggcggcaatgcc
tccgatgttgcctacggctacccattcatgcgccaaggcgctgccgtgcctggcacgtgg
aaagatgacgccaccggctccggcacgtatggcaatggcgtaaccaccaagcaggccgac
aaagacaagctggctgcggcattcgacccgactgacgacaaccagtatgacttctccaag
tccgccgcccaagactggtggattgagcgcggtgccaccggcgataaccctgacatcacc
gacgtagaggccttcgccaactccgctccgtggttcctgaccaacagcggttacgccact
ggtggacgcaactccggtagcaataatcttgcaaaccctgagaaattcgctcagtacatg
gccaagaacgtcgagcacctcgaaagccttggcgcaaacgttgacacggtcgagccgttc
aacgagtccgagaccagttactggggcactccgggcgacatggcttcgaagtacaccgat
gagagcgatgacaacaccaagctcattaacaactactgggataagtactactccgacaaa
gataggtccgtcaccccatactccaacgcgctgaagaagccgcaggagggtatgcatgtc
agcaacgcccagcagcagcagacgattaccgcactcgctgaggcgctcaaggacaatgat
gacaccaccatcgcagccaccgatgccacgaactccgccgacttcgtcaagtcgtacaac
cagtacccgcaggcgatcaaggaccttatcggccagtacaacgttcacgcctactccgac
agcaaccagatgcagtcgcgcgatatcgctcaggcagacggcaagaagctgtcgatgagc
gaggtggacggctcctggcagtctggctcctacaacccgtacggtttcgacaacgcgctg
ggcatgatgagcaagatcagctccaacgtcacccgcctgcagtccaaggacttcaccttc
tggcaggtggtcgaggacctctacaacatgcagatgggctcgaatgtgaatccggccggc
gagaacaccaactggggcaccgtgctcatcgacttcgactgcaccgtggctggcatggac
ggcaagctctactccgagcgccgcgtgaacaacaacggcggtaccaccgatggacttgaa
ccgtgcacggttattgcaaacgccaagtacaacggcgtcaaggccatcacccacttcatc
cacgcgggcgacaaggtcatcgccaacaacgatgaagacaacaacatgactgccacctcc
gacgatggcaagacacagaccgtcatccaccgcaactccggcacctctgaccagaccttc
gtcatcgacctgtcgaagtacggcgagattgccgacaacgcttacggtgagctctacctg
accaccgaaacctctgccgaagacaagaacgcgggtgtcgattccgccactccggaagtc
ttcgccaagaccagcaacgtcaagcaagctgaaggctctgtgatgattgacaaggctgcc
aagaccgctacggtcactgtgcccgcccgttctatcgcctccatccagctcactggcgtg
accggctacgctaaggatgctgccgtcgagaccggcgacacttaccagctcgttggtaag
cagtccggcaaggccgtggctgataccacttctggtgattccgcgctgtccctggccaac
gtcgcttccgatgccgagaacgccaagaagcagacttggacctttacccagatcgagcag
cccgccgactccgagcgccctgatctcaaggcttatgtgattactaacgccgaaggcaag
gtgctggtgtccaaggatggcacgaacgcgctttccaacgaaacggttgaggccgctaag
tccgacccggctgccaagtggattctcaacacttccgatggttcgacctaccagctgctc
aatgccgcgactaagacgaacctcgatgtggataactctggtaccacagtcggcacgaag
gttggcttgtggcagtcaccgagcggcacttcgccgtccgccaaccagacatggactcta
cgcaatgtaacgccgaccagccagaagaccgtgaacgtgcagaccgccgttaacgagaag
gccgcgctgccgaccgaagtcacgctctactacacctggggcgaaggcaaggccacggtt
gccaactgggatacttccaaggtcgatgtggccaaggaaggcacctacgaagccaccgct
accgccaccgatgtgtacggcaacgagttcaatgtcgccgctacggtctacgttggcgcg
ctcaccgtttccgatccggtatcggctacagtgctggccggcaccagtgcgagcgaggcg
aaggccgcgcttgaggctgcgccggtgtatctgcacgtcaaggcatcgcctgcattcgag
ggcgatgcggctaaggttacgtggaacttcgatgggcttgataccaagctcgccgatgcc
aaggctggcgacaacattgccgtgaccggtacgtaccagctggacgacgcgaccacgatt
gcgctgaagggcacgatctatgtcaccgccgccacgcctgagaatgtggccgacactgct
tccagcctgaccgtgaccaaccagcagacggaatacagcaagggcgatcagtggaagaag
ctcaccgatggtgacacgtcagctgaagcctgggtgacgtggaactctgctggtgactat
tccgccagcccgaccgccacgattgacttcggctctgagtgtgagcttagcagcgtgacc
attacgtatggtgacaaggctccggcttccgccaaggccgagtacaccactgatggcgag
acgtggatgcaattcggtagcgatgttaagcctgccgcaggccagacggtgacgttcaag
gccgataagggcacagtgaatgccacgaaggtgcgcattgtgaacaccgtgaacaacgac
tacatgaacgccaccgaaattcaggcattcgtgacgccggttcagggtgctgcgaagaac
atcgccgcggcctctggcacgaacttctcggtgaacttccaggagggtgcctccgcttcc
aaggccatcgatggtgacactacgtcaaagggttggtccacttgggcttccaccgcctcg
acggtggacccggtcgccacgttcaccttcgacgaagctcagaccatcaccgaagtgaag
accttcttctactacgatggtcgtgcgtcttggccgaagagccagacgctggaataccag
aatgaggctggcgaatggcatggagtcggtaccaaggatggctggaagatacaggccggc
gatgccggctctggctccgacggcatcaccgccgccgacaccccgaccgttgacttcgtg
ctcggcaccccggtaaaggccaaggccatccgcctgactaacacattgcaggacaccaag
gtgtacatcaacgtggctgagatccaggtgttcgcacaagacagcacggtactcaccccg
cagccagcatccgatgccacgctgggcgacctgcgtcttgacggcgaaaccgttgaaggc
ttcgacccgtccaagaccgactacacggttgatctgccggtcgacgccgaggcaaacccg
gtgctgcaggccttcgccaccgacaatgccgccgccgtcaaggtgactggcgacgcggtt
gagaacggcaagcttggcggcaaggccgccattacggtgacctcagccgacgagtctgag
acgaagacctacacggtgaccttcaacgccttcactttggcttcgctcaaggtgatcgga
cccacgaagaccgagtacgccatcggcgacaagctcgataccgccggtctgaaggtgact
gccgtctaccagagtgtcgacaagaccaaggaagtgccggtcgctcttgacgatccgcag
cttgcgattggctcgttcgactccaccaccgcaggcaagaaggcgattaccgtctcctac
cgtggtgtgaccgcgaccttcaacgtcacggtcaaggccaacgcagtcgcccctggccct
gaagaacagaagcccggcaacaccaacaagcccggtgccaccggcaacggcaacaagaac
acggtggccaacaccggttccagtgttgccgccatcgctggcgctgtcgctctgctggcc
gctgccgcgggtgcactgttcatgctgcgcaagcgtgcatag

DBGET integrated database retrieval system