KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00036
Entry
BLNIAS_00036      CDS       T01845                                 

Definition
(GenBank) hypothetical protein
  KO
K24100  galactan exo-1,6-beta-galactobiohydrolase (non-reducing end) [EC:3.2.1.213]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Brite
KEGG Orthology (KO) [BR:blk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BLNIAS_00036
Enzymes [BR:blk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.213  galactan exo-1,6-beta-galactobiohydrolase (non-reducing end)
     BLNIAS_00036
SSDB
Motif
Pfam: Big_3 F5_F8_type_C RicinB_lectin_2 Big_4 Cadherin-like DUF5344
Other DBs
NCBI-ProteinID: AEI96592
UniProt: F8AR81
Position
30717..35258
AA seq 1513 aa
MKVLSKSLAAMVAAATLVGGGAFAVAGTAYAADNDAITVTPNPWYANSFDGWGTSLAWFA
NATGSLGEESAITTNLGDDASKAKAVEYGKQLREQFYQSIFGDEGLDLNMARYNVGGGNA
SDVAYGYPFMRQGAAVPGTWKDDATGSGTYGNGVTTRQADKDKLAAAFDPTDDNQYDFSK
SAAQDWWIERGATGDNPDITDVEAFANSAPWFLTNSGYATGGRNSGSNNLANPEKFAQYM
AKNVEHLESLGANVDTVEPFNESETSYWGTPGDMASKYTDESDDNTKLINNYWDKYYSDK
DKSVTPYSNALKKPQEGMHVSNAQQQQTITALAEALKDNDDTIIAATDATNSADFVKSYN
QYPQAIKDLIDQYNVHAYSDGSQMQSRDIAQADGKKLSMSEVDGSWQSGSYNPYGFDNAL
GMMSKISSNVTRLQSKDFTFWQVVEDLYNMQMGSNVNPAGENTNWGTVLIDFDCTVAGMD
GKLYSERRVNNNGGTTDGLEPCTVIANAKYNGVKAITHFIHAGDKVIANNDEDNNMTATS
DDGKTQTVIHRNSGTSDQTFVIDLSKYGEIADNAYGELYLTTETSAEDKNAGVDSATPEV
FAKTSNVKQAEGSVMIDKAAKTATVTVPARSIASIQLTGVTGYAKDAAVETGDTYQLVGK
QSGKAVADTTSGDSALSLANVASDAENAKKQTWTFTQIEQPADSERPDLKAYVITNAEGK
VLVSKDGTNALSNETVEAAKSDPAAKWILNTSDGSTYQLLNAATKTNLDVDNSGTTVGTK
VGLWQSPSGTSPSANQTWTLRNVTPTSQKTVNVQTAVNEKAALPTEVTLYYTWGEGKATV
ANWDTSKVDVAKEGTYEATATATDVYGNEFNVAATVYVGALTVSDPVSATVLAGTSASEA
KAALEAAPVYLHVKASPAFEGDAAKVTWNFDGLDTKLADAKAGDNIAVTGTYQLDDATTI
ALKGAIYVTAATPENVADTASSLTVTNQQTEYSKGDQWKKLTDGDTSAEAWVTWNSAGDY
SASPTATIDFGSECELSSVTITYGDKAPASAKAEYTTDGETWMQFGSDVKPAAGQTVTFK
ADKGTVNATKVRIVNTVNNDYMNATEIQAFVTPVQGAAKNIAAASGTNFSVNFQEGASAS
KAIDGDTTSKGWSTWASTASTVDPVATFTFDEAQTITEVKTFFYYDGRASWPKSQTLEYQ
DEAGEWHGVGTKDGWKIQAGDAGSGSDGITAADTPTVDFVLGTPVKAKAIRLTNTLQDTK
VYINVAEIQVFAQDSTVLTPQPASDATLGDLRLDGETVEGFDPAKTDYTVDLPVDAEANP
VLQAFATDNAAAVKVTGDAVENGKLGGKAAITVTSADESETKTYTVTFNAFTLASLKVIG
PTKTEYAIGDKLDTAGLKVTAVYQSGDKTKEVPVALDDPQLAIGSFDSTTAGKKAITVSY
RGVTATFNVTVKANAVAPGPEEQKPGNTNKPGATGNGNKNTVANTGSSVAAIAGAVALLA
AAAGALFMLRKRA
NT seq 4542 nt   +upstreamnt  +downstreamnt
atgaaggtactgagcaaatcgcttgctgcaatggttgcggcggcaacactagtgggagga
ggggcgtttgcggttgccggcactgcgtatgcggctgataacgatgccattaccgtgacc
ccgaacccgtggtatgccaacagtttcgatggctggggcacctcgctggcttggttcgcc
aacgccaccggcagcctcggcgaggaatcggccatcaccaccaatctcggcgatgacgct
tccaaggctaaggctgtggaatacggcaaacagctgcgcgaacagttctaccagtccatc
ttcggtgatgaaggactggacctgaacatggcccgctacaacgtgggcggcggcaatgcc
tccgatgttgcctacggctacccattcatgcgccaaggcgctgccgtgcctggcacgtgg
aaagatgacgccaccggctccggcacgtatggcaatggcgtaaccaccaggcaggccgac
aaagacaagctggctgcggcattcgacccgactgacgacaaccagtatgacttctccaag
tccgccgcccaagactggtggattgagcgcggtgccaccggcgataaccctgacatcacc
gacgtagaggccttcgccaactccgctccgtggttcctgaccaacagcggttacgccact
ggtggacgcaactccggtagcaataatcttgcaaaccctgagaaattcgctcagtacatg
gccaagaacgtcgagcacctcgaaagccttggcgcaaacgttgacacggtcgagccgttc
aacgagtccgagaccagttactggggcactccgggcgacatggcttcgaagtacaccgat
gagagcgatgacaacaccaagctcattaacaactactgggataagtactactccgacaaa
gataagtccgtcaccccatactccaacgcgctgaagaagccgcaggagggtatgcatgtc
agcaacgcccagcagcagcagacgattaccgcactcgctgaggcgctcaaggacaatgat
gacaccatcatcgcagccactgatgctacaaactccgctgactttgtcaagtcgtacaac
cagtacccgcaggcgatcaaggaccttatcgatcagtacaatgttcacgcctactccgac
ggcagccagatgcaatcgcgcgatatcgctcaggcagacggcaagaagctgtcgatgagc
gaggtggacggctcctggcagtctggctcctacaacccgtacggtttcgacaacgcgctg
ggcatgatgagcaagatcagctccaacgtcacccgcctgcagtccaaggacttcaccttc
tggcaggtggtcgaggacctctacaacatgcagatgggctcgaatgtgaatccggccggt
gagaacaccaactggggcaccgtgctcatcgacttcgactgcaccgtggctggcatggac
ggcaagctctactccgagcgccgcgtgaacaacaacggcggtaccaccgatggacttgaa
ccgtgcacggttattgcaaacgccaagtacaacggcgtcaaggccatcacccacttcatc
cacgcgggcgacaaggtcatcgccaacaacgatgaagacaacaacatgactgccacctcc
gacgatggcaagacgcagaccgtcatccaccgcaactccggcacctctgaccagaccttc
gtcatcgacctgtcgaagtacggcgagattgccgacaacgcttacggtgagctctacctg
accaccgaaacctctgccgaagacaagaacgcgggtgtcgattccgccactccggaagtc
ttcgccaagaccagcaacgtcaagcaagctgaaggctctgtgatgattgacaaggctgcc
aagaccgctacggtcactgtgcccgcccgttctatcgcctccatccagctcactggcgtg
accggctacgctaaggatgctgccgtcgagaccggcgacacttaccagctcgttggtaag
cagtccggcaaggccgtggctgataccacttctggtgattccgcgctgtccctggccaac
gtcgcttccgatgccgagaacgccaagaagcagacttggacctttacccagatcgagcag
cccgccgactccgagcgccctgatctcaaggcttatgtgattactaacgccgaaggcaag
gtgctggtgtccaaggatggcacgaacgcgctttccaacgaaacggttgaggccgctaag
tccgacccggctgccaagtggattctcaacacttccgatggttcgacctaccagctgctc
aatgccgcgactaagacgaacctcgatgtggataactctggtaccacagtcggcacgaag
gttggcttgtggcagtcaccgagcggcacttcgccgtccgccaaccagacatggactcta
cgcaatgtaacgccgaccagccagaagaccgtgaacgtgcagaccgccgttaacgagaag
gccgcgctgccgaccgaagtcacgctctactacacctggggcgaaggcaaggccacggtt
gccaactgggatacttccaaggtcgatgtggccaaggaaggcacctacgaagccaccgct
accgccaccgatgtgtacggcaacgagttcaatgtcgccgctacggtctacgttggcgcg
ctcaccgtttccgatccggtatcggctacagtgctggccggcaccagtgcgagcgaggcg
aaggccgcgcttgaggctgcgccggtgtatctgcacgtcaaggcatcgcctgcattcgag
ggcgatgcggctaaggttacgtggaacttcgatgggcttgataccaagctcgccgatgcc
aaggctggcgacaacattgccgtgaccggtacttaccagctggacgacgcgaccacgatt
gcgctgaagggcgcgatctatgtcaccgccgccacgcctgagaatgtggccgacactgct
tccagcctgaccgtgaccaaccagcagacggaatacagcaagggcgatcagtggaagaag
ctcaccgatggtgacacgtcagctgaagcctgggtgacgtggaactctgctggtgactat
tccgccagcccgaccgccacgattgacttcggctctgagtgtgagcttagcagcgtgacc
attacgtatggtgacaaggctccggcttccgccaaggccgagtacaccactgatggcgag
acgtggatgcaattcggtagcgatgttaagcctgccgcaggccagacggtgacgttcaag
gccgataagggcacagtgaatgccacgaaggtgcgcattgtgaacaccgtgaacaacgac
tacatgaacgccaccgaaattcaggcattcgtgacgccggttcagggtgctgcgaagaac
atcgccgcggcctctggcacgaacttctcggtgaacttccaggagggtgcctccgcttcc
aaggccatcgatggtgacactacgtcaaagggttggtccacttgggcttccaccgcctcg
acggtggacccggtcgccacgttcaccttcgacgaagctcagaccatcaccgaagtgaag
accttcttctactacgatggtcgtgcgtcttggccgaagagccagacgctggaataccag
gatgaggctggcgaatggcatggagtcggtaccaaggatggctggaagatacaggccggc
gatgccggctctggctccgacggcatcaccgccgccgacaccccgaccgttgacttcgtg
ctcggcaccccggtaaaggccaaggccatccgcctgactaacacattgcaggacaccaag
gtgtacatcaacgtggctgagatccaggtgttcgcacaagacagcacggtactcaccccg
cagccagcatccgatgccacgctgggcgacctgcgtcttgacggcgaaaccgttgaaggc
ttcgacccggccaagaccgactacacggttgatctgccggtcgacgccgaggcaaacccg
gtgctgcaggccttcgccaccgacaatgccgccgccgtcaaggtgactggcgacgcggtt
gagaacggcaagcttggcggcaaggccgccattacggtgacctcagccgacgagtctgag
acgaagacctacacggtgaccttcaacgccttcactttggcttcgctcaaggtgatcgga
cccacgaagaccgagtacgccatcggcgacaagctcgataccgccggtctgaaggtgact
gccgtctaccagagcggcgacaagaccaaggaagtgccggtcgctcttgacgacccgcag
cttgcgattggctcgttcgactccaccaccgcaggcaagaaggcgattaccgtctcctac
cgtggtgtgaccgcgaccttcaacgtcacggtcaaggccaacgcagtcgcccctggccct
gaagaacagaagcccggcaacaccaacaagcccggtgccaccggcaacggcaacaagaac
acggtggccaacaccggttccagtgttgccgccatcgctggcgctgtcgctctgctggcc
gctgccgcgggtgcactgttcatgctgcgcaagcgtgcatag

DBGET integrated database retrieval system