KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00293Help
Entry
BLNIAS_00293      CDS       T01845                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
blk03010  Ribosome
Brite
KEGG Orthology (KO) [BR:blk00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    BLNIAS_00293
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:blk03011]
    BLNIAS_00293
Ribosome [BR:blk03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    BLNIAS_00293
  Bacteria
    BLNIAS_00293
  Archaea
    BLNIAS_00293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 DUF4145
Motif
Other DBs
NCBI-ProteinID: AEI96763
UniProt: F8AS61
Position
256514..256873
Genome map
AA seq 119 aa AA seqDB search
MEAKAIARHVRVTPRKARRMVDLIRGKKATEAVTILKFAPQAAALPVRKTLESAIANARV
KADKAGEPFRENDLYIKETYVDEGVTLKRFRARAQGRAARINKRTSHITVVVANKEGAR
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atggaagctaaagcaatcgctcgtcacgtccgcgtgacgccgcgcaaggctcgccgcatg
gtcgacctcatccgcggcaagaaggcgaccgaagccgtcaccattttgaagttcgcccct
caggctgcggccctgccggtccgcaagaccctggagagcgccatcgccaacgctcgtgtg
aaggccgacaaggccggcgagccgttccgcgagaacgacctgtacatcaaggagacctac
gttgacgaaggtgtgaccctcaagcgcttccgcgctcgtgcccagggccgcgctgctcgc
atcaacaagcgcacctcccacatcacggtcgtcgtggctaacaaggaaggagcccgctaa

DBGET integrated database retrieval system