KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00391Help
Entry
BLNIAS_00391      CDS       T01845                                 

Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
blk00010  Glycolysis / Gluconeogenesis
blk00260  Glycine, serine and threonine metabolism
blk00680  Methane metabolism
blk01100  Metabolic pathways
blk01110  Biosynthesis of secondary metabolites
blk01120  Microbial metabolism in diverse environments
blk01130  Biosynthesis of antibiotics
blk01200  Carbon metabolism
blk01230  Biosynthesis of amino acids
Module
blk_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLNIAS_00391
  Energy metabolism
   00680 Methane metabolism
    BLNIAS_00391
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BLNIAS_00391
Enzymes [BR:blk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BLNIAS_00391
Membrane trafficking [BR:blk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BLNIAS_00391
Exosome [BR:blk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BLNIAS_00391
  Exosomal proteins of melanoma cells
   BLNIAS_00391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEI96830
UniProt: F8ASK9
Position
329197..329937
Genome map
AA seq 246 aa AA seqDB search
MTYKLVLLRHGQSAWNKTNQFTGWVDVPLTEQGEAEAKRGGELLKEKNVLPDIVFTSLLR
RAINTANIALDAADRLWIPVQRDWRLNERHYGALQGKNKTEIREEYGDEKFMLWRRSYAT
PPPEIDPNDQYAQNNDPRYAGDPVPEAECLANVVERVKPYFESAIEPELKAGKTVLIAAH
GNSLRAIVKMLDNLSEEEIAKVNIPTAIPLLYELDENFKPIKPRGEYLDPEAAAAGAAAV
AAQGQK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacttataaactagtactgctccgtcatggacagagcgcatggaataaaaccaaccag
ttcaccggctgggtcgacgtaccgctgaccgagcagggtgaagccgaagccaagcgtggc
ggcgagctgctcaaggagaagaacgtccttccggacatcgtgttcacctccctgctgcgt
cgcgccatcaacaccgccaacatcgctctggatgccgcagatcgtctgtggattccggtt
cagcgtgactggcgtctcaacgagcgtcactacggcgctctgcagggcaagaacaagacc
gagatccgcgaagagtacggcgacgagaagttcatgctgtggcgccgttcttacgccacc
ccgccgcccgagatcgacccgaacgaccagtacgcccagaacaacgacccgcgctacgcc
ggcgatccggttccggaagccgagtgcctggccaacgttgttgagcgtgtgaagccgtac
ttcgagtccgctatcgagccggagctcaaggccggcaagaccgtgctgattgctgcccac
ggcaactccctccgcgccatcgtcaagatgctggacaacctgtctgaggaagagatcgcc
aaggtcaacatcccgaccgccatcccgctgctctacgagctggacgagaacttcaagccg
atcaagccgcgtggcgagtacctggacccggaggctgctgctgccggtgccgccgctgtc
gccgctcagggccagaagtga

DBGET integrated database retrieval system