KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00760Help
Entry
BLNIAS_00760      CDS       T01845                                 

Definition
(GenBank) sugar ABC transporter ATP-binding protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
blk02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:blk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BLNIAS_00760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:blk02000]
    BLNIAS_00760
Enzymes [BR:blk01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     BLNIAS_00760
Transporters [BR:blk02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    BLNIAS_00760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_30 RsgA_GTPase SbcCD_C AAA_23 MMR_HSR1 AAA_27 AAA_22
Motif
Other DBs
NCBI-ProteinID: AEI97081
UniProt: F8ATZ3
Position
632767..634308
Genome map
AA seq 513 aa AA seqDB search
MTDKNPIVVMKGITIEFPGVKALDGVDLTLYPGEVHALMGENGAGKSTMIKALTGVYKIN
AGSIMVDGKPQQFNGTLDAQNAGIATVYQEVNLCTNLSVGENVMLGHEKRGPFGIDWKKT
HEAAKKYLAQMGLESIDPHTPLSSISIAMQQLVAIARAMVINAKVLILDEPTSSLDANEV
RDLFAIMRKVRDSGVAILFVSHFLDQIYEITDRLTILRNGQFIKEVMTKDTPRDELIGMM
IGKSAAELSQIGAKKARREITPGEKPIVDVKGLGKKGTINPVDVDIYKGEVVGFAGLLGS
GRTELGRLLYGADKPDSGTYTLNGKKVNISDPYTALKNKIAYSTENRRDEGIIGDLTVRQ
NILIALQATRGMFKPIPKKEADAIVDKYMKELNVRPADPDRPVKNLSGGNQQKVLIGRWL
ATHPELLILDEPTRGIDIGAKAEIQQVVLDLASQGMGVVFISSELEEVVRLSDDIEVLKD
RHKIAEIENDDTVSQATIVETIANTNVNTGKEA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgacagataaaaaccccatcgtcgtaatgaaaggcattacgattgaattcccgggcgtc
aaggccttggatggtgttgatttgactctctacccgggtgaagttcacgccctgatgggt
gagaacggtgcaggcaagtccaccatgattaaggctctgaccggtgtgtacaagatcaac
gccggctccattatggtggacggcaagcctcagcagttcaacggcaccctcgacgcacaa
aacgccggtatcgccaccgtgtatcaggaagtgaacctgtgcaccaacctttccgtcggt
gagaacgtgatgctgggccacgaaaagcgcggccccttcggcatcgactggaagaagacc
cacgaggccgccaagaagtatttggcacagatgggcctcgaatccattgacccgcacact
ccgctgagctccatctccatcgctatgcagcagctggtcgccatcgcccgcgctatggtt
atcaacgccaaggtgctgattctcgatgagccgacctcttcgctggatgccaacgaggtc
agggacctgttcgcgatcatgcgcaaggtgcgtgactcgggcgtggccatcctcttcgtc
tcccacttcctcgatcagatttatgagattaccgatcgtctgaccattctgcgtaacggc
cagttcatcaaggaggtcatgaccaaggacaccccgcgcgacgaactcatcggcatgatg
attggtaagtccgccgccgagctgtcccagattggtgccaagaaggctcgccgtgaaatc
acccctggcgagaagccgatcgtcgatgtcaagggcctcggcaagaagggcaccatcaac
ccggttgatgttgacatctacaagggtgaggtcgttggcttcgctggcctgctgggctcc
ggtcgtaccgagcttggtcgactcctgtatggtgccgacaagccggattcgggtacctac
acgctcaacggcaagaaggtcaacatctccgatccgtacacggctttgaagaacaaaatc
gcgtactccaccgaaaaccgtcgtgatgagggcatcatcggcgacctgaccgtccgccag
aacatccttatcgccctgcaggcaacgcgcggtatgttcaagccgattcccaagaaggaa
gcggacgccatcgttgacaagtacatgaaggaactcaacgttcgtcccgccgacccggat
cgcccggtcaagaatctctccggcggcaaccagcagaaggtgctcattggccgttggctg
gccacgcaccccgagctgctgattctggacgagccgacccgtggtatcgatatcggtgcc
aaggctgaaattcagcaggtcgtgcttgacctggcttctcagggcatgggcgttgtcttc
atctcctccgagcttgaagaggtcgtgcgtctgtccgacgacatcgaggttctcaaggac
cgccacaagatcgcagaaatcgaaaacgacgacaccgtctctcaggcgaccatcgtcgaa
accatcgctaacaccaacgtaaacaccggaaaggaggcatga

DBGET integrated database retrieval system