KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_00824Help
Entry
BLNIAS_00824      CDS       T01845                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Pathway
blk00230  Purine metabolism
blk01100  Metabolic pathways
Module
blk_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:blk00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    BLNIAS_00824
Enzymes [BR:blk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     BLNIAS_00824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 CPT AAA_33
Motif
Other DBs
NCBI-ProteinID: AEI97121
UniProt: F8AUB0
Position
681062..681652
Genome map
AA seq 196 aa AA seqDB search
MTENTHAGRLIVLTGPTAVGKGTVEAKLRADHPEVWVSVSATTRAPRPGEVDGVNYWFLT
EDEFLAREAAGEFLETAVVHGMAHYGTLLKPVEEHLAAGVPTILEIDLQGARRVKQRAAE
LDLEVVYVFIAPPSFEELERRLIGRGTETAEQQARRLETAKVELAAESEFDVTIVNETVD
QAAADLWSVIAKEYGL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaaacacccatgctggccgtctaatcgtcctgactggccccaccgcagtaggt
aagggcaccgtggaagccaagctgcgcgccgaccaccccgaagtgtgggtgtccgtctcc
gccaccacacgcgctccgcgcccgggcgaggttgatggcgtcaactattggttcctcact
gaagacgagttcctggcccgtgaggcggccggtgagttcctggaaactgcagtggtgcac
ggcatggcccattatggcaccttgttgaagcctgtggaggaacatctggccgccggtgtg
cccacgattctggaaatcgacctgcagggtgcccgccgcgtcaagcagcgcgccgccgag
ctcgacctcgaagtggtgtacgtgttcatcgcgccgccaagcttcgaagagctcgagcgc
cgcctgatcggccgcggcaccgaaaccgccgaacagcaggcccgtcgcttggagaccgcc
aaggtggagctcgccgccgaaagcgaattcgacgtcaccatcgtcaacgaaaccgtcgat
caggccgctgccgacctctggtccgtcatcgccaaggaatacgggctgtaa

DBGET integrated database retrieval system