KEGG   Bifidobacterium longum subsp. longum KACC 91563: BLNIAS_01581Help
Entry
BLNIAS_01581      CDS       T01845                                 

Definition
(GenBank) hypothetical protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
blk  Bifidobacterium longum subsp. longum KACC 91563
Brite
KEGG Orthology (KO) [BR:blk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BLNIAS_01581
Enzymes [BR:blk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     BLNIAS_01581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: AEI97621
UniProt: F8AQM7
Position
complement(1243673..1244077)
Genome map
AA seq 134 aa AA seqDB search
MPPIVDIDGWKIGVMTCYDVRFPETARSLAVRGADAIVVSAAWVRGPLKEQHWKLLTAAR
ALENTCYVLACSEVSSRNIGCSRIINPMGEVVASAGDEGAELIATGLSRECLASARQIMP
VLQNRRFADPQLRD
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
ttgccgcctatcgtcgatattgacggttggaagatcggcgtcatgacctgttatgacgta
cgattccctgagacggcgcgttctctggccgtgcgcggggcagatgcgattgttgtaagc
gccgcttgggtgcgcggcccgttgaaagagcagcattggaagctgctgactgcggctcgc
gcattggaaaacacttgctatgtgttggcttgcagtgaggtgagttcgcggaacatcgga
tgcagccgtatcatcaatccgatgggtgaggttgtcgcttcggcgggcgatgagggagct
gagcttattgctactgggcttagtcgcgaatgccttgcttccgcacgccagataatgccg
gttctgcagaatcgccgttttgccgacccgcagttgcgtgattag

DBGET integrated database retrieval system