KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0025Help
Entry
BLJ_0025          CDS       T01240                                 

Definition
(GenBank) carbonic anhydrase
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:bll00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    BLJ_0025
Enzymes [BR:bll01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     BLJ_0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pro_CA ADH_N
Motif
Other DBs
NCBI-ProteinID: ADG99522
UniProt: D6ZX76
Position
complement(31362..32045)
Genome map
AA seq 227 aa AA seqDB search
MAQSDFEQESTANATWSRMLQGNRRFAEGKPDHPWQDKETRQTLLDGQNPDAAVLSCSDS
RVPPEIIFDQGLGDLFTVRTAGQLIDSAVIASLEYAVKKLHVSLICVLGHEHCGAIEAAE
QELDDLMHTITSEADGSLEAADAMDDLDEHIAAAESIILRQAGMSVWQAREAELDAHEDI
ERVHVAHTIETLVEQSPIIQQALAADQLMIVGARYQLDTGKVEVLSF
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtcagactttgaacaggaatcaaccgcgaacgcaacgtggagccgcatgctg
caaggcaaccggcgctttgccgagggcaagcccgaccacccatggcaggacaaggagacc
cgccagacgctgcttgatggccagaacccggatgccgcggtgctctcctgctcggactcg
cgcgtacctccggaaatcatttttgatcagggcctgggcgacctgttcaccgtgcgcacc
gccgggcaactcatcgatagcgcggttatcgcctcgctggagtacgcggtcaagaaactg
cacgtcagcctgatctgtgtgctcggtcacgagcactgcggcgcaatcgaggccgccgag
caggagctggacgacctgatgcacaccatcacttccgaagccgacggctcactggaggcc
gcggatgcgatggacgacctcgacgagcacatcgccgccgccgaatcgattattctgcgc
caggccggcatgtccgtctggcaggcgcgcgaagccgagctcgacgcgcatgaagacatc
gagcgcgtacacgtggcccacaccatcgagacgctggtggaacaatcccccatcattcag
caggcattggccgccgaccagctgatgatcgtcggcgcccgttaccagctcgacaccggc
aaggtcgaggtgctgagtttctga

DBGET integrated database retrieval system