KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0029Help
Entry
BLJ_0029          CDS       T01240                                 

Definition
(GenBank) hypothetical protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADG99526
UniProt: D6ZX80
Position
36754..36867
Genome map
AA seq 37 aa AA seqDB search
MSISWFDMFSFAASVLTTVTAAFESPGRASTEGLILG
NT seq 114 nt NT seq  +upstreamnt  +downstreamnt
atgtccatttcttggtttgacatgttttcgtttgcagcgtcggtgctcaccacggtgacc
gcggcgttcgagtcgccgggcagggcctcgaccgagggtctcatcctcggctga

DBGET integrated database retrieval system