KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0042Help
Entry
BLJ_0042          CDS       T01240                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3
Motif
Other DBs
NCBI-ProteinID: ADG99538
UniProt: D6ZX92
Position
57501..58898
Genome map
AA seq 465 aa AA seqDB search
MASDTELWRGTDYGWWLAADTSGAVGASLIAFAVPLIMLATTGSSAAATTTESICVVVQT
VLGLAGGVIQDRYDRRTLMLIWGASGVVLSAVAAAAVMLFGNAPKTSGHGGNGANAPAFG
GPYAHVLPIALLCIVVLFSVRDGLLENTSNAMLRGVVPDEQLPHAMALNDARDSTVTLAG
GPLGGLLMTVGHAVPFLTSAVLSVLGMVSAWRIRRYWKRATVSDSGRPGNVDTGSEVGAV
SDTDDADGSAPRWRDALDGMIWLLRDRFQRHLIIAAAMVTGASNAFLLLTALDISQGGSQ
LISAGFINAASAVGMLLGALMASQLVNRVPGGVLVGVMFVLLAVGFTGAALVPSMVGKAI
FVACSVLALPAGNAVLGGLSNTLVGKDKLGRVGAGSMVLQYGAYGVAVALAGWGMQTIGY
GPTCLILATVLVAAAAYALTMRSLITLPTPDRWAEHIQRWSIAQF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgatacggaattatggcggggaactgattacggatggtggctggctgcggac
acgtccggcgcggtcggtgccagcctgatcgcgttcgcggtgccgctgatcatgctcgcc
acgacaggatcctctgccgccgccaccacgacggaaagcatctgcgtggtggtgcagacg
gtgctgggccttgccggcggcgtgattcaggaccggtatgatcgccgtacgctcatgctg
atctggggtgcgtccggtgtggtgctctcggcggtggcggcggcagcggtgatgctgttc
ggcaatgcgccgaagacgagcggccatgggggtaacggggcaaacgctccggcattcggc
ggaccgtatgcccacgtgcttccgatcgcgctgctgtgtatcgtcgtgctgttttcggtg
cgcgatggcctgttggagaatacatcgaatgccatgctgcgtggcgtggtgccggatgag
cagctgccgcacgcgatggcgctgaacgacgccagggattcgacggtcacgctggcaggc
gggccgttgggcggtctgctgatgaccgtgggacatgcggtgccgtttctgaccagcgcg
gtgctgagcgtgctgggcatggtgtccgcatggcgtatccgccgctattggaaacgtgcg
actgtgagcgatagcggccgtccgggcaatgttgataccggttcggaggtcggggccgtc
tcggacaccgatgatgccgatggctccgccccacgctggcgcgacgcactggacggcatg
atctggctgctgcgtgaccggttccaacgccatctcatcatcgcagcggccatggtgacc
ggtgccagcaatgccttcctgctgctgaccgcgctggacatctcccaaggtggcagccag
ctgatatccgccggattcatcaacgccgcctccgccgttggcatgttgctgggcgcactg
atggcctcgcaactggtcaaccgcgtgcccggcggcgtactggtgggcgtgatgttcgtc
ttgctggctgtaggattcaccggtgccgcgttggtgccctccatggttggcaaggccata
tttgtggcctgctcggtactggcattgcccgcgggcaacgcggtgcttggaggcctcagc
aataccttggtgggcaaggacaagctcggccgcgttggagcgggcagcatggtgttgcag
tacggtgcctatggcgtggccgtggcactcgccggctggggtatgcagaccatcggctac
ggtccgacctgcctgattctggccaccgtactggtagctgccgccgcttacgcgctgacg
atgcgcagcctcatcaccctacccacgccggaccgctgggccgagcacatccagcgttgg
agcatcgcccagttctga

DBGET integrated database retrieval system