KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0049Help
Entry
BLJ_0049          CDS       T01240                                 

Definition
(GenBank) sortase family protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sortase
Motif
Other DBs
NCBI-ProteinID: ADG99545
UniProt: D6ZX99
Position
65409..66647
Genome map
AA seq 412 aa AA seqDB search
MRHGRHNSGAPAPIDLASVSDVQPFPEDDAARMAADPANASRARSRRAAVRGASSPQRSL
IWQALGICAELLITAAVICALYIVWQMWWTGVEAERAQNETTQSVDWSDPSNNGGTVTIA
KAQEGDAPVQPKDAKYGDLIAQIYIPRFGSQWHRNIVEGTTLEQLNRHGLGHYDTTQMPG
QVGNFAVAGHRNGYGQPLGDVDKLQEGDPIIVRTKDYWYVYHYTRYEIVLPTDVYVIAPN
PEDSTANPTKRMITLTTCEPKYSTPTHRWISYGELAYWAKVSDGVPKELATTDSSGAVKF
STTETPSIASRIGSLDKVVFGALVVWLVLFIAAAVAWRWPVLREIRAGERRRPDASIYGG
LLRLQPGVAPIRWLLLALLLFAAAAALFQWGFPWAAANIPFLQQMSNFVAVS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagacacggcaggcacaacagcggcgcaccggcgcccattgatctcgcgtccgtgtcg
gacgtacagcccttccccgaggacgacgccgcacgaatggcggcagacccggccaatgcc
agcagggcaaggtcccgtcgtgccgcagtacgcggcgcgtcttcgccccagcggagcctg
atctggcaggcactcggcatctgcgccgaactgctgattaccgctgccgtgatttgcgcc
ctgtacatcgtctggcagatgtggtggaccggtgtcgaggcggagcgagcccagaacgaa
accacccagtccgtcgactggagcgaccccagcaacaacgggggaacggtcaccatcgcc
aaagcccaggagggcgatgctccagtacagccgaaagacgcgaaatatggcgacttgatt
gcgcagatctacattccgcgcttcggctcccaatggcatcgcaacatcgtggaaggcacc
acgctcgagcagctcaatcgccacggtctgggccattacgacaccacccagatgccgggg
caggtcggcaacttcgccgtcgccggccaccgcaacggctacgggcagccgttgggcgat
gtggacaagttgcaggaaggcgatcccatcatcgttcgtaccaaggattactggtacgtc
taccactacacccggtacgagattgtgctgcccacggacgtgtatgtgatcgcgcccaat
ccggaagactccactgccaatcccaccaaacgcatgatcacactgactacctgtgagccg
aaatactccacccccacccatcgatggatcagctatggtgagttggcgtactgggccaaa
gtgtctgatggcgtgcccaaagagctggctactactgattcgtccggtgcagtgaagttc
tccaccaccgaaaccccctcgatcgcttcccgcattggctcgctggacaaggtggtattc
ggcgcgctggtagtgtggctggttctgttcatcgccgctgcggtggcatggcgctggccg
gtgctgcgcgagattcgcgcgggtgagcgtcgccgcccggatgccagcatctatggcgga
ctgttgcgtctgcagcccggcgtggcaccgattcgatggctgctgctggctctgctgctg
ttcgcagccgccgcggcgctgttccagtggggattcccttgggccgccgccaatatccca
ttcctacagcagatgtcgaacttcgtggcagtgagctga

DBGET integrated database retrieval system