KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0062Help
Entry
BLJ_0062          CDS       T01240                                 

Definition
(GenBank) hypothetical protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: ADG99558
UniProt: D6ZXB2
Position
82941..84038
Genome map
AA seq 365 aa AA seqDB search
MKLSKSKIIGLIALLAVVGVVCGTLVWRQSQPAPAEPTEQVSITGYLGGEKIGLFDDAKF
KALAAKQGIAIDYRKAGSLAMMDADRKGMDYLFPSSRAAVEYGNAKGVKAIQSDIVFNSP
IVLYTHKAVADGLVNGGLMTKDDSGAYHMDMAKAVDAMVANTTWADVGYTAGYGQFRIDS
TDPVKSNSGNEYAALLATVLNGGQPATVDSVARDGKTIASIFAKSGWMETSSEDSFNQFL
TLGVGSKPMMVGYESQLLDLAVNQPDAFKQIKDDVVIVYPTPTVWSTHTLMALDEKGGTL
LNLLKTPAVQKLAWERHGFRAANFAGTDSISRFGVPGTLDQIPAVSELPNNDAMQQLIAT
LQSTQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctccaaatcaaaaatcatcggactgatcgccctgcttgcggtagtgggcgtg
gtctgcggcacgctggtgtggcggcaatcgcaaccagcgccggccgaaccgaccgaacag
gtgagcatcaccggctacctgggcggcgagaaaatcggcctgttcgatgacgccaagttc
aaggcgcttgccgccaagcaaggcatcgccatcgactatcgcaaggccggatcgctggcc
atgatggatgcggaccggaaaggcatggattacctgttcccctcctcgcgcgcggccgtc
gaatacggcaatgcgaaaggcgtcaaggccatccaaagcgacatcgtcttcaactcaccg
attgtgctgtacacgcacaaggccgtggcggacgggctcgtgaacggcggacttatgacc
aaggacgattcgggcgcgtaccacatggatatggccaaagccgtggacgcgatggtcgcc
aacacaacctgggccgacgtcggatacacggcaggctacgggcagttccgcatcgactcg
accgatccggtgaagtcgaactcaggcaacgaatacgcggcgctgctcgccacggtgctc
aatggcgggcagccggccacggtcgattcggtggcgcgcgacggcaagaccatcgcctcc
atcttcgccaaatccggttggatggagacctcttccgaggattcgttcaaccagttcctg
accttgggcgtgggctccaagccgatgatggtgggctacgaatcgcagctgcttgatttg
gccgtgaaccaaccggatgcgttcaagcagatcaaggacgacgtggtcatcgtctacccg
acgccgaccgtgtggagcacccacacgctgatggccttggacgagaaaggcggcacactg
ctgaacctgttgaaaacaccggcggtgcagaagctggcgtgggagcgccacggcttccgc
gcggccaacttcgccggcaccgattcgatcagccgattcggcgtgcccggcacgctcgac
cagatccccgccgtatccgaactgcccaacaacgacgccatgcaacaactcatcgccacc
ctccaatccacgcaataa

DBGET integrated database retrieval system