KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0063Help
Entry
BLJ_0063          CDS       T01240                                 

Definition
(GenBank) TelA-like protein associated with cryptic tellurite resistance
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TelA
Motif
Other DBs
NCBI-ProteinID: ADG99559
UniProt: D6ZXB3
Position
84249..85430
Genome map
AA seq 393 aa AA seqDB search
MPQNITLADLTKSSATPITNPLLNTNQAAPNTTLVPTAAEAQAAAALTPDQQIAKLPEAD
QATVNQMAGQIDFTRDGIESSYGKDAQRATSTFADEILSDTRSKDTGEAGELLNTMLVTI
DEADLGGFRTIPIIGQVAVSVDKLRRRYQKVDAQIDEIIVRLESAQAKLVADISMYDTMY
TQNAQQYRELKMTVLAGKKALADFNANQLPALEAEAAASGDAMQAQVLKDFKSKLDRFAK
RLDDLDRISVVTLQTAPQIKIIQNADQTIVDKIDTTISTTIPVWKSQMVIALGLSNQRKA
LDLQNKADDVTNKLLARNAAALHKGAVDAEKANQRSVVEIDTLEKINAELIATLKETVQI
QKEGKANREAAQVKMRQIESDLKNALLENAQQM
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgccccaaaacatcaccctcgcagacctcaccaaaagctccgcaacccccatcaccaac
ccgttactcaacaccaaccaagccgcccccaacaccaccctcgtccccaccgccgccgaa
gcccaagccgccgcggccctgaccccggaccagcagatcgccaaattgcccgaagccgac
caggccacggtcaaccagatggccggccagatcgacttcactcgcgacggcatcgaatcc
agctacggcaaggacgcccagcgcgccacctccaccttcgccgacgaaatcctctccgac
acccgctccaaagacaccggcgaggcgggcgaactactgaacaccatgctggtcaccatt
gacgaggctgacctcggcggcttccgcaccattccgatcatcggccaggtggccgtcagc
gtggataagctgcgccgccgctatcagaaagtcgacgcgcaaatcgacgaaatcatcgtg
cgtctcgaatccgcgcaagccaaactcgtggccgacatctccatgtacgacacgatgtac
acgcagaacgcccagcaataccgcgagctgaaaatgaccgtactggccggcaagaaggcg
ctcgccgacttcaacgccaaccagctgccagcgctggaggccgaggccgccgccagtggc
gacgccatgcaggcgcaagtgctgaaggacttcaagtccaagctcgaccgttttgccaag
cgactcgacgacctcgaccgcatcagcgtggtcaccttgcagaccgcgccgcagatcaaa
atcatccagaacgcggaccagaccatcgtggacaagatcgacaccaccatctccaccacg
attccggtgtggaagagccagatggtgatcgcgctgggcctgtccaaccagcgcaaggcc
ctcgacctgcagaacaaggccgacgatgtgaccaacaagctgctggcgcgtaacgcggcc
gccctgcacaagggtgcggtggacgcggaaaaggccaaccagcgttccgtggtggaaatc
gacacgctggagaagatcaacgccgaactcatcgccaccctgaaggagaccgtgcagatc
cagaaggaaggcaaggccaaccgcgaggccgcccaggtcaagatgcgccaaatcgagtcc
gacctcaaaaacgccttgctcgaaaacgcccagcagatgtga

DBGET integrated database retrieval system