KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0070Help
Entry
BLJ_0070          CDS       T01240                                 

Definition
(GenBank) hypothetical protein
  KO
K07005  uncharacterized protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
KEGG Orthology (KO) [BR:bll00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BLJ_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridox_ox_2
Motif
Other DBs
NCBI-ProteinID: ADG99566
UniProt: D6ZXC0
Position
94167..94766
Genome map
AA seq 199 aa AA seqDB search
MSMENIAGARKPAKREDEHTVAGEHRMMRRADREVTDPERIAAIIAACDIVEVAYADAEG
LTIVPLNFGFDYDEATGKLTLWFHSAPRGRKLDAIRAAAGGRLPVAFTMQTDCEVVAGRT
TCNWGEAFKSIVGNGTASLVEDLDECRHGLQTLMAQQAHMPNVEFTDAQVRSVTVWKIES
DYFTTKVRTKPVPAHMHQR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagcatggagaatatcgcgggcgctcgcaagcccgccaagcgtgaggatgagcacacg
gtcgccggcgagcatcgcatgatgcgccgtgcggaccgcgaggtgaccgatcccgagcgg
atcgccgcgatcatcgccgcctgcgacatcgttgaagtggcctatgcggatgctgagggc
ctgactatcgtgccgctgaatttcggctttgattacgacgaggcgactggcaagctgacg
ctctggttccactccgcgccgcgcggccgcaagctcgacgcgattcgcgccgccgccggt
ggccgactgcccgtggctttcaccatgcagaccgactgcgaggtggtggcgggccgcacc
acgtgcaattggggtgaggcgttcaagtcgatcgtcggcaatggcacggcgtcactggtc
gaggatctggatgaatgccgccacggcttgcagacgctgatggcacagcaggcgcatatg
ccgaatgtggaattcactgatgcgcaggtccgcagcgtcacggtgtggaagattgagtcc
gactacttcaccaccaaagtccgcaccaaacccgtgcccgcacacatgcatcagcgttag

DBGET integrated database retrieval system