KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0074Help
Entry
BLJ_0074          CDS       T01240                                 

Definition
(GenBank) mutator MutT protein
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
KEGG Orthology (KO) [BR:bll00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bll03400]
    BLJ_0074
Enzymes [BR:bll01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     BLJ_0074
DNA repair and recombination proteins [BR:bll03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    BLJ_0074
 Prokaryotic Type
    BLJ_0074
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX NUDIX_4
Motif
Other DBs
NCBI-ProteinID: ADG99570
UniProt: D6ZXC3
Position
complement(99112..99525)
Genome map
AA seq 137 aa AA seqDB search
MERERKIINVVGAAIVTNGTVLCAQRGPGKSLAGYWEFPGGKIEPHETARQALHREIEEE
LLCEVEVAEEVCTSEYAYDFGTVRLTTFICHLIAGTPHLTEHTDIRWLNPADMPTLNWAP
VDREAVAIIANKQLTLR
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atggagcgggaacgcaaaatcattaacgtcgtgggagctgcaatcgtcaccaacggcacc
gtactatgcgcccagcgtggcccgggaaagtcgttggccggatactgggagttccccggc
ggcaaaattgagcctcatgaaacagcgcggcaagccttgcaccgcgaaatcgaagaagag
ctgttatgcgaagttgaggtcgcggaagaggtatgtaccagcgaatacgcctacgacttt
ggaaccgtgcggctcaccacattcatctgtcacctcatcgccggtacgccgcatctcacc
gagcacactgatatccgatggctgaatcctgctgatatgccgacattgaactgggctccg
gtagatcgcgaagcagtcgcgattatcgcgaacaaacaactgacgctccgatga

DBGET integrated database retrieval system