KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0076Help
Entry
BLJ_0076          CDS       T01240                                 

Definition
(GenBank) Hly-III family protein
  KO
K11068  hemolysin III
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
KEGG Orthology (KO) [BR:bll00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bll02042]
    BLJ_0076
Bacterial toxins [BR:bll02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, Other
   BLJ_0076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HlyIII FAM199X DUF2842
Motif
Other DBs
NCBI-ProteinID: ADG99572
UniProt: D6ZXC6
Position
complement(100720..101577)
Genome map
AA seq 285 aa AA seqDB search
MSVSISTPSGRNMASAATVAPSTTASQKSSASTSPTALDHASAQYRAAQSRYRQAKAALK
AIKRQIVPVDAFGNRKPRLRGWLHLATLPLCIAASIVLICIAPAGPVKAACAVYGASAML
LFGNSALLHVVPWRSAKVTRVLCGIDYSNIFLIIAGTNTPVLFALSPAIRRPYLTVIWAT
AAIGTILHIVWLRTPNWVFTTVYVVLGLAPVTLIPQLWTAPAVGPAPTVLIACGGAAYIA
GAVCFALRKPNPVPGWFEFHEVFHLGTVIGYVCHVVSIYLIVCAL
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtttccatcagcacgccatctggacgaaacatggcttccgccgcaacagttgcg
ccttccacaaccgcgagtcaaaaatccagcgcaagcaccagccccaccgcactggaccac
gcatcggctcagtacagggccgcgcaatcgcgctatcgccaagccaaggccgcgctgaag
gcgatcaaacgccaaatcgtccccgtggacgcattcggcaatcgcaagccgcgcctgcgc
ggatggctgcacctcgccaccctgccgctgtgcatcgcggcgtccatcgtactgatctgt
atcgcgccggcagggcccgtcaaagcggcgtgcgcggtgtacggcgcctcggccatgctg
ctgttcggcaacagcgcgctgctgcacgtcgtgccgtggcgcagcgcgaaggtgactcgc
gtgctgtgcggcatcgattattcgaacatcttcctcatcatcgccggcaccaacacaccc
gtgctgttcgcgctcagcccggcgattcgccggccatatctgacggtgatctgggcgacc
gcggcgatcggcacgatactgcatatcgtctggctgcggacgccgaactgggtgttcacc
accgtctacgtcgtgctgggactggccccggtaacgcttattccgcagctctggacggct
cccgcagtaggcccggcgccgaccgtgctcatcgcgtgcggaggcgccgcatatatcgcc
ggcgccgtatgctttgcgctacgcaagccgaatcccgtccccggctggttcgagtttcac
gaggtgtttcacttgggcacggtcatcgggtatgtctgccacgtcgtgtcgatttatctg
attgtctgcgcgctgtag

DBGET integrated database retrieval system