KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0080Help
Entry
BLJ_0080          CDS       T01240                                 

Definition
(GenBank) peptidase S1 and S6, chymotrypsin/Hap
  KO
K08372  putative serine protease PepD [EC:3.4.21.-]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bll00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BLJ_0080
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:bll01002]
    BLJ_0080
Enzymes [BR:bll01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     BLJ_0080
Peptidases [BR:bll01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   BLJ_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trypsin_2 PDZ_2 Trypsin PDZ Peptidase_S46
Motif
Other DBs
NCBI-ProteinID: ADG99575
UniProt: D6ZXC9
Position
104556..106616
Genome map
AA seq 686 aa AA seqDB search
MADEFNPQGVDQTPRNNENPNSTADTGNAEPKNPFVGGDSVDAGNASDSSEQQAPVSSAA
LAADQQPTQAATDTAATEPIPDYASAKGESTVVSSSPASPAAPAAGQTSATTPLYRPAPE
YGAYGPTPTQAQGQQGGQAGNNAQPTQQFPFGQPAQQTPQGQQGNRNPYYTNNPQPQGNG
NPFNPPTQPQQNIGNPFASQSGQSGQNGRNGQQPQQGGLFGFGTPGTGTPNGQGPAQPGQ
PGQPGPAKQGMSKTASNILIAVVAAVVSAALCLGLGYGALTSGLITLPTSNSLSNVSSNK
SGSGSATAKSGEAPDWQTVASDVSGSVVSIQTALSNGTAKGSGAIIDTEGHIITNNHVIS
GAQQIQVTLANGNMYSATLVGTDTTTDLAVIKLDNPPSDLKAVEFADSDKLAVGENVMAI
GNPLGYDDTATTGIVSALNRPVTVTDDNNNEIVTNAVQIDATINPGNSGGPTFNAAGQVI
GINSSIASTATSSDSAGSIGIGFAIPSNLVKRVADEIIKDGKVKHVALGVVIKSDTVEAD
GVTRGGATITKSSATGSAVVSGGPADKAGLKEGDTIVAFNGNAVNNNYSLLGYVRAAALG
DKVTLTIVRDGKTMDVDVTLDQEESSVNGSSGANGNSNGQNNKRNRNGDGANGNNGGDDG
NGQNGNGRNDGGTGDGGGFTDPFGLW
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaatttaacccgcagggcgtcgaccagaccccgcggaataacgaaaacccc
aatagtactgccgataccggcaacgccgagccgaagaacccgtttgtgggtggcgactcg
gttgatgccggcaacgccagcgattccagcgagcagcaagccccggtttcctcggccgcc
ctcgctgccgatcagcagcctacgcaagccgctaccgacactgccgccaccgagcccatc
ccggactacgcctccgccaagggcgagagcacggtggtctcctcctcgccggcttctccg
gcagcaccggccgcaggccagacctcggccacaactccgctgtatcgcccggccccggaa
tacggcgcttatggtccgaccccgactcaggcacagggccagcagggcggccaggccggc
aacaatgcccagcccacgcagcaattcccgttcggtcagcctgcacagcaaaccccacag
ggccagcagggcaaccgcaatccctactacaccaataacccgcagccgcagggcaacggc
aatccgttcaatccgcccacgcagccgcagcagaacatcggcaacccattcgccagccag
tccggccagtccggtcagaatggccggaatggccagcagccccagcagggcggtctgttc
ggtttcggcactcccggtaccggtacgccgaacggtcaaggcccggcccagccgggacag
cccggtcagcccggccccgccaagcagggcatgtccaagacggcgagcaacatcctcatc
gccgtggtcgccgccgtcgtgtccgcggccctctgcctgggcctcggctacggcgccctc
accagcggcctgatcaccttgccgaccagcaattcgctgtccaacgtcagctcgaataag
tccggctccgggtccgccaccgccaagagcggcgaagcccccgactggcagaccgtcgcc
agcgatgtctccggctccgtggtctccatccagaccgcgttgagcaacggcaccgccaag
ggctccggcgccatcatcgacaccgaaggccacatcatcaccaacaaccacgtgatctcc
ggtgcccagcagattcaggtgacgcttgccaacggcaacatgtattccgccacgctcgtc
ggcaccgacaccaccaccgatcttgcggtcatcaagctcgacaacccgccgagcgacctc
aaggccgtggaattcgccgattccgacaagctcgccgtcggcgagaacgtgatggccatc
ggcaacccgcttggctacgacgacaccgccaccaccggtatcgtctccgccctgaaccgc
ccggtgaccgtgaccgacgataacaacaacgagatcgtcaccaacgccgtccagatcgac
gcgaccatcaaccccggcaactccggcggcccgaccttcaacgcggccggccaggtgatc
ggcatcaactcgtccatcgcctcgaccgccacctcatccgactccgccggttcgatcggc
atcggcttcgccatcccgtccaacctcgtcaagcgtgtggccgacgaaatcatcaaggac
ggcaaggtcaagcacgttgccctcggcgtggtcatcaagtccgacacggttgaagccgac
ggcgtgacccgcggcggcgcgaccatcaccaagtccagcgccaccggcagcgcggtcgtc
tccggcggcccggccgacaaggccggcctcaaggagggcgacaccatcgtggccttcaac
ggcaacgcggtgaacaacaactactcgctgctcggctacgtgcgtgccgcggccctggga
gacaaggtgacgctgaccatcgtgcgcgatggcaagaccatggacgtggacgtgacgctc
gatcaggaggagtcgtcggtgaacggctcgtccggcgccaacggcaacagcaacggccag
aacaacaagcgcaaccggaacggcgacggcgccaacggcaacaacggcggcgacgatggc
aacggccagaacggcaacggccgcaacgatggaggcaccggtgacggcggcggcttcacc
gatccgttcggtctgtggtaa

DBGET integrated database retrieval system