KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0081Help
Entry
BLJ_0081          CDS       T01240                                 

Definition
(GenBank) heavy metal translocating P-type ATPase
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Hydrolase Hydrolase_3 HAD Solute_trans_a ResIII
Motif
Other DBs
NCBI-ProteinID: ADG99576
UniProt: D6ZXD0
Position
107014..109173
Genome map
AA seq 719 aa AA seqDB search
MSALIRFFTKILDICKLVPMLPVVVIAAIPLALLGDWRPWGNAMAIPVLGNPGFGQWLVI
ALVLIIVIDTVRGMIDDLRHGQVGVDVLAVVAILSTVAVAEYWASWAVTLMITSGEAIEE
YAQAKAERSLTALMEAAPQTAHVVNLPGVGCGFATDKGDSSDGFRRVGLALAAAAAHHFD
TVPVEQVQLGDVLMVLPGETVPVDGELLSGTATLDLSNINGEPVPREVFAGARVMSGAVN
GSTALTMRATQVAADSQYQRILELVASAQESRPAVVKTADRLAVPFTVLSLMIAGIAWAM
SGVPTRFAQVLVLATPCPLLIAAPVAYIAGTGRLAAAGVLIKAQDVLENLGRVTQVFFDK
TGTLTVKQPQVVRVEMLPGAATRLNEDHVLMMAGVVESYSVHILSKGIAKAGVEAMARLR
QRFEDGQRLCPEPEASWPGHGREYPVVKNINEDAGKGVSGEVNGHAVRVGRLSFAAAGED
GFLAVGEAAPLSPRSGQLPLRGGAQQKDDLRTRFGLLQPDEMASYVSVDGRLIARIVLRD
VPRANAKAVLAKLHELGVTELAMLTGDKRASANIIASEVGIDEVHAELFPEDKVAAVRAA
TGAGKTVTMMVGDGVNDAPVLAVADIGVAMTDGTSTAASESAQVVIMNDNIAAVPRAIAI
ARRTKRVMLQAVIAGLVLATIGMIAAAFNLIPVVVGAFLQEAIDVVSILWALTALIDRD
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcactcatcagattcttcaccaaaattctcgacatctgcaagcttgtgccgatg
cttccggtcgtcgtcatcgccgcgattccgttggctttactaggcgattggcgtccgtgg
ggcaatgcgatggcgattccggtactcggcaatccgggcttcggccagtggctggttatc
gcattggtgctgattatcgtgattgacactgtgcgcggcatgattgacgatttgcgccac
gggcaggtcggggttgatgtgctggccgtggtcgcgatcctctccaccgtggccgtcgcc
gaatactgggcaagttgggcggtgacgctgatgattacgtccggcgaggccattgaggaa
tacgcccaagccaaggccgagcgcagtctgaccgcgcttatggaagccgcgccgcagacc
gcacacgtcgtcaacctgcctggtgtggggtgtgggtttgctaccgataagggcgattcg
tccgatggcttccggcgtgtgggcttggcgttggctgcggccgccgcgcaccacttcgac
acggtgccggtcgagcaggtgcagctgggcgatgtactcatggtgctgccgggcgaaact
gtgccggttgacggtgagctgctgtccggcacggccacgctcgacctgagcaatatcaac
ggtgagccggtgccgcgtgaagtgttcgccggcgcccgcgtgatgtccggcgcggtgaac
ggctcgactgcattgaccatgcgtgccacccaggtggccgccgattcgcagtaccagcgc
atcctcgagctcgtggcctccgcgcaggagtcgcgcccggccgtggtaaaaaccgccgac
cgcttggctgtgccctttaccgtgctctcgctgatgattgccggcatcgcatgggcgatg
tccggggtgccgacgcgattcgcccaggtgctggtgctggccacgccctgcccgctgctc
atcgccgcaccggtggcgtacatcgccggaaccggacgcctcgccgcagccggcgtgctt
atcaaagcgcaggacgtgttggaaaaccttggccgcgtcacgcaggtgttcttcgacaaa
accggtacgctcaccgtcaagcagccgcaggtcgtgcgcgtcgagatgctgcccggcgcc
gcaacccgtctcaacgaagaccatgtgctgatgatggccggcgtggtggaaagctactcg
gtgcacatcctgtccaaaggcattgccaaggctggcgtggaggcgatggcccgactgcgc
cagcggttcgaggatggtcagcgcctatgccccgagccggaggccagctggcccggccat
ggacgggagtatccggtcgtcaagaacatcaatgaagacgccggcaaaggcgtttccggc
gaggtgaacggccacgcggtgcgcgttggccggctgtctttcgcggccgccggggaggat
ggattcctggcggtcggcgaggctgcccccctcagcccgcgaagcggccagctcccccta
agagggggagctcagcaaaaagatgacctgcgcactcgctttggcctgctgcagccggat
gagatggcgtcgtatgtgtccgttgacggccggctgatcgcgcgcatcgtgctgcgcgac
gtgccgcgcgccaacgccaaggcagtgctcgccaaactgcatgagttgggcgtcaccgag
ctcgccatgcttaccggtgacaagcgggcttccgccaatatcattgccagcgaagtcggc
attgacgaggttcacgccgaactgttcccggaggataaggtagccgcagtcagggccgct
acaggagccggcaaaaccgtcacgatgatggttggtgacggtgtgaatgatgccccggtg
ctcgctgttgccgatatcggcgtggccatgaccgatggcacgtccaccgccgcgtccgaa
agcgctcaggtggtcattatgaatgacaatatcgccgccgtgccgcgcgccatcgccatt
gcacgccgcaccaagcgcgtgatgcttcaagccgtaatcgcgggccttgtgcttgccacc
atcggcatgattgccgccgcgttcaaccttatcccggtcgtcgtcggtgccttcctccag
gaggccatcgacgtggtgagcatcctctgggccctcactgccctaattgatcgggactga

DBGET integrated database retrieval system