KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0082Help
Entry
BLJ_0082          CDS       T01240                                 

Definition
(GenBank) AAA+ superfamily ATPase
  KO
K07133  uncharacterized protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
KEGG Orthology (KO) [BR:bll00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BLJ_0082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4143 HTH_28 HTH_23 HTH_Tnp_ISL3 Phage_terminase Sigma70_r4_2 HTH_24 GerE Terminase_5 HTH_11 HTH_AsnC-type Mfa2
Motif
Other DBs
NCBI-ProteinID: ADG99577
UniProt: D6ZXD1
Position
complement(109513..110244)
Genome map
AA seq 243 aa AA seqDB search
MPLNLFFSNYIDTYIERDVSEYLDVRNLAEFRRFLTLCALSSGALINYTNIANELGVSPR
TVKAWMSILESSYIAFHLMPFYTNARKQVVKTPKLYFYDTGLLCHLLGIRTVEALVAHPK
FGDIFENLIIAETMKQHLNANQEPQLFFYRDASKVEVDLLDFTDPNNRMLIEIKSGQTYH
DRFARHLTLIGNILGIPCEQQYVTSRVEHSYVSQGIRVTSAPRLARRPTVKSRRRAVGIL
CNQ
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcaatctgttcttctcgaactacatcgacacttatatcgaacgtgatgtttcc
gaatatcttgatgtacgcaatttggctgaattccgccgattcttgactctttgcgcactc
agttccggagcactcataaactacaccaacatcgccaatgaacttggtgtaagtccgcga
accgtaaaggcatggatgtcgattctggaatcaagttacatcgcattccatctcatgccg
ttctacacgaacgcacgcaaacaggtggtcaaaacgccgaaactctatttctatgacact
ggcttgctgtgtcatctcttgggcattcggacggtcgaagcactggttgcgcatcccaag
ttcggcgatatatttgaaaacctcatcattgcggaaaccatgaaacagcatttgaacgcc
aatcaggagccgcaattattcttctaccgcgatgccagcaaggtcgaggtggatttgttg
gatttcaccgatcccaacaaccgtatgctcatagaaatcaaatccggacaaacctatcat
gaccggttcgcccgccatctcactttaattggcaatattctcggtataccgtgtgagcaa
cagtacgtaaccagtcgggttgagcatagttatgtctcacaaggaatccgcgtcacctcc
gcccctcgattggctagaaggccgacggtaaagagccgccgcagagcagtaggaattctg
tgcaatcagtga

DBGET integrated database retrieval system