KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0087Help
Entry
BLJ_0087          CDS       T01240                                 

Definition
(GenBank) fructose-bisphosphate aldolase, class II
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll00010  Glycolysis / Gluconeogenesis
bll00030  Pentose phosphate pathway
bll00051  Fructose and mannose metabolism
bll00680  Methane metabolism
bll01100  Metabolic pathways
bll01110  Biosynthesis of secondary metabolites
bll01120  Microbial metabolism in diverse environments
bll01130  Biosynthesis of antibiotics
bll01200  Carbon metabolism
bll01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bll00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BLJ_0087
   00030 Pentose phosphate pathway
    BLJ_0087
   00051 Fructose and mannose metabolism
    BLJ_0087
  09102 Energy metabolism
   00680 Methane metabolism
    BLJ_0087
Enzymes [BR:bll01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BLJ_0087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase
Motif
Other DBs
NCBI-ProteinID: ADG99581
UniProt: D6ZXD6
Position
115839..116936
Genome map
AA seq 365 aa AA seqDB search
MEAMTIATAERYAEMLDAARHGGYAYPAINVTSTQTLNAALQGFAEAESDGIIQVSVGGS
SYFSGQSVNDRVVGSLAFAAFAHEVAKRYPNITVALHTDHCAKQYLDGWVRPLLAHEAEQ
VKRGEEPTFQSHMWDGSTVPLEENLDIAAELLEKSVRAHTVLEIEIGAVGGEEDGHSAEI
NEKLYSTPTDGVRVAERLGLGEHGRYMAAFTFGNVHGAYKPGVVKLRPELLRDIQSEVWD
AALDGRLGSLGASAVSTCALPDMPERKPFALVFHGGSGSTPDEIARAVSYGVVKMNIDTD
TQYAFTRAVAGHMFAHYDAVLKIDGEVGNKKLYDPRSWGREAESAMAARVVEACRQLGSA
GKALK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggaagccatgactatcgcaactgccgaacgctatgccgaaatgctggatgccgcccgc
cacggcggatacgcctatcccgcgatcaacgtgaccagcacgcagacgctcaacgccgca
ctgcagggattcgccgaggccgagtccgacggcatcatccaggtgtcggtcggcggctcc
tcctacttctccggccaaagcgtgaacgaccgcgtggtcgggtcgctcgcgttcgccgca
ttcgcgcacgaggtggcgaagcgctacccgaacatcacggtcgcgctgcacaccgaccat
tgcgccaagcagtacctggacggctgggtccgcccgctgctcgcgcacgaggccgaacag
gtcaagcgcggcgaagagccgacgttccagtcgcatatgtgggacggctcgactgtgccg
ctggaggagaacctggacatcgccgcggagctgctcgagaaatccgtccgcgcgcatacg
gtgctggagatcgagatcggcgcggtcggcggcgaggaggacggccattccgcggagatc
aacgaaaagctgtattccacgccgaccgacggcgtgcgcgtggcggagcggctcggcctc
ggcgagcacggccgctatatggccgctttcaccttcggcaacgtgcatggcgcatacaag
ccgggtgtggtcaagctccgcccggaactgctgcgcgacatccagtccgaagtgtgggac
gcggccctcgacggccgtcttgggtcgctgggcgcgtcggcggtgtccacgtgcgcgctg
ccggacatgcccgagcgcaagcccttcgcgctggtgttccacggcggttccggctccacg
cccgacgagatcgcccgcgcggtgagctacggcgtggtcaagatgaacatcgacacggac
acgcagtacgccttcacgcgcgcggtcgccggccacatgttcgcgcattacgacgccgtg
ctcaagatcgacggcgaggtcggcaacaagaagctgtacgacccgcgctcctggggccgc
gaggccgaatcggccatggccgcccgcgtggtcgaggcgtgccggcagctcggctcggcc
ggcaaggcattgaagtag

DBGET integrated database retrieval system