KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0088Help
Entry
BLJ_0088          CDS       T01240                                 

Definition
(GenBank) Uracil-DNA glycosylase superfamily
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:bll00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    BLJ_0088
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bll03400]
    BLJ_0088
Enzymes [BR:bll01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     BLJ_0088
DNA repair and recombination proteins [BR:bll03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     BLJ_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: ADG99582
UniProt: D6ZXD5
Position
complement(115058..115849)
Genome map
AA seq 263 aa AA seqDB search
MASIIPPPSDESHCRGGLGGECAQDHLAREARSSPTTRTYAANRRKRGTTTMEPVSDIRH
SPLEGRRPKRTELAGFVDGTVDDIRCPHPKLLIVGINPGLWTAAVNAPFAYPGNRFWPSL
FASGLTPWQVDASYGLRLRDERMMIDRGIGLTNLVNRATAKASELNTAELRQGADRLREL
CARVHPRAIAILGITAYRQAFADKSAALGLQDLTAEETDRFGGAQLWVIPQPSGLNAHAT
MPVLVDWWRRVADAAGLDLAAAR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggcttccattatcccgccgccgagtgacgaatcgcattgtcggggaggcctcggcggc
gaatgtgcgcaagatcaccttgcccgcgaggcgcggagctcaccgacaactcgaacctac
gccgcaaaccgccgtaagcggggcacgactaccatggaacccgtgagcgatattcgacat
tctccgctggaaggccggcggccgaagcgcaccgagctcgccggtttcgtcgacggcacg
gtcgatgacatccgctgcccgcaccccaaactgcttatcgtgggcatcaaccccgggtta
tggacggccgcggtcaacgcacccttcgcctatcccggcaaccgattctggccgtcgctt
ttcgcctcggggctcacgccgtggcaggtggacgccagttacggcctgcgccttcgcgat
gagcgcatgatgatcgaccgcggcatcgggcttaccaatctcgtcaatcgcgccaccgcg
aaagcgagcgagctgaacaccgccgagctgcgtcagggcgccgatcggctgcgggagctg
tgcgcgagggtccatccccgggccattgcgatactgggcatcacggcgtaccgacaggcg
ttcgccgataagtccgccgcgctggggctgcaggacctcaccgcggaagagaccgaccgg
ttcggaggcgcgcagctgtgggtgattccccagcccagcgggttgaacgcgcacgccacc
atgccggtgctggtcgactggtggcgcagggtcgccgacgcggccggcctggatctcgcc
gccgcgcgctag

DBGET integrated database retrieval system