KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0093Help
Entry
BLJ_0093          CDS       T01240                                 

Definition
(GenBank) Camphor resistance CrcB protein
  KO
K06199  fluoride exporter
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
KEGG Orthology (KO) [BR:bll00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bll02000]
    BLJ_0093
Transporters [BR:bll02000]
 Other Transporters
  Pores ion channels [TC:1]
   BLJ_0093
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CRCB SepZ DUF3040
Motif
Other DBs
NCBI-ProteinID: ADG99586
UniProt: D6ZXE0
Position
122157..122552
Genome map
AA seq 131 aa AA seqDB search
MMWMICLFGGLGAMARYVLDVSIQQGWNRENRRTNRNFPLSTLVINGVASLCAGIAMMSY
YSQSVDMDTVMMFVVGFLGGFSTFSTALNEVVSLIRQRRFTLALGYGIATVAVPLICVAA
GFGIALLANPA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgatgtggatgatctgtctgttcggcggtctgggcgccatggcccgttacgtgctcgac
gtgtcaattcaacaaggctggaaccgcgagaatcgaagaacgaaccgcaacttcccgcta
tccacgctcgtcatcaacggcgtcgcctcgctatgcgcgggcatcgccatgatgtcctac
tattcgcaatcggtggatatggacacggtcatgatgttcgttgtcggatttctcggtggt
ttctcaacattctccacggcgctcaacgaagtggtttcattgattcgccagcgtcgtttt
acgctggctctgggctatggaatagcaaccgtcgcggtgcctctcatttgtgtggccgcc
ggtttcggcattgcgctgcttgccaatccggcgtaa

DBGET integrated database retrieval system