KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0097Help
Entry
BLJ_0097          CDS       T01240                                 

Definition
(GenBank) ABC-type branched-chain amino acid transport systems ATPase component
  KO
K01996  branched-chain amino acid transport system ATP-binding protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll02010  ABC transporters
bll02024  Quorum sensing
Module
bll_M00237  Branched-chain amino acid transport system
Brite
KEGG Orthology (KO) [BR:bll00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BLJ_0097
 Cellular Processes
  Cellular community - prokaryotes
   02024 Quorum sensing
    BLJ_0097
Transporters [BR:bll02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Branched-chain amino acid transporter [MD:M00237] [OT]
    BLJ_0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_23 AAA_22 MMR_HSR1 AAA AAA_33 RsgA_GTPase AAA_16 AAA_27 AAA_15 AAA_30 AAA_14 AAA_24
Motif
Other DBs
NCBI-ProteinID: ADG99590
UniProt: D6ZXE4
Position
126065..127021
Genome map
AA seq 318 aa AA seqDB search
MSDVTNATDPTCVSAASVSDSGESDNRERVEVAYVSDSPESDTQGDMQSATQGGAQETGA
LSRAQIHVGEPEGEPLLDAVDLVAGYLPGVNILNGASLTLHEGEIVGIIGPNGAGKSTLL
KSLFGLVHIHSGKLLLKGEDITNLRADKLVSRGVGFVPQTENVFPSLTIAENMHMGAFQA
PKLFEERFDYVCSIFPKLGQRKNQLAGQLSGGERQMVAMARALMMKPSVLLLDEPSAGLS
PMLQDETFIRVRQVNKAGVSVVIVEQNARRCLQICDRGYVLDQGRNAYSGKGRDLMNDPK
VVSLYLGNLEEEVQEEGR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgttacgaacgcaactgatccgacgtgtgtttctgccgccagtgtgtccgat
tctggagaatcggacaaccgtgagcgtgttgaggtggcttatgtgtccgattctccagaa
tcggacacgcagggtgacatgcagagcgccacgcagggaggcgcgcaggagacgggggca
ttatcccgtgcgcagattcatgtgggggaaccggagggcgagcctctgcttgacgcggtg
gatttggtggccggctaccttcctggcgtgaatattctcaatggcgcgtccctcacgctt
catgagggtgagatcgtcggcattattggcccgaatggtgccggaaagtccacgctgctg
aagtcgctgttcggcctggtgcatattcattccggcaagcttctgctcaagggcgaggac
atcaccaatctgcgtgccgacaagctcgtgtcccgaggcgttggcttcgtgccgcagact
gaaaacgtcttccccagcctgaccatcgcggaaaacatgcatatgggcgctttccaggcg
ccgaagctgttcgaggagcggttcgactacgtatgctccatcttccccaagctcggtcag
cgcaagaaccagcttgccggccagctttccggaggcgaacgccagatggtggccatggcc
cgggccctgatgatgaagccgtcagtcctcctgctggacgagccttccgcgggcctgtcg
ccaatgcttcaggacgaaaccttcatccgcgtgcgccaggtcaacaaggccggcgtctcc
gtggttattgtcgaacagaacgcccgccgttgcctgcagatctgcgaccgtggctatgtg
ctcgaccaaggtcgcaacgcctactccggcaagggccgtgatttgatgaacgatccgaag
gttgtctccttgtacttgggcaatctggaagaggaggtccaggaagagggcaggtaa

DBGET integrated database retrieval system