KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0100Help
Entry
BLJ_0100          CDS       T01240                                 

Definition
(GenBank) Sucrose phosphorylase
  KO
K00690  sucrose phosphorylase [EC:2.4.1.7]
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:bll00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BLJ_0100
Enzymes [BR:bll01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     BLJ_0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1964 Alpha-amylase Gal4_dimer DUF2119
Motif
Other DBs
NCBI-ProteinID: ADG99593
UniProt: D6ZXE7
Position
130372..131898
Genome map
AA seq 508 aa AA seqDB search
MKNKVQLIAYADRLGDGTLSSMTDILRTRFDGVYDGVHILPFFTPFDGADAGFDPIDHTK
VDPRLGSWDDVAELSKTHGIMVDAIVNHMSWESKQFQDVLEKGEESEYYPMFLTMSSVFP
NGATEEELAGIYRPRPGLPFTHYKFAGKTRLVWVSFTPQQVDIDTDSDKGWEYLMSIFDQ
MAASHVSYIRLDAVGYGAKEAGTSCFMTPKTFKLISRLREEGVKRGLEILIEVHSYYKKQ
VEIASKVDRVYDFALPPLLLHSLFTGHVEPVVHWTEIRPNNAVTVLDTHDGIGVIDIGSD
QLDRSLKGLVPDEDVDNLVNTIHANTHGESQAATGAAASNLDLYQVNSTYYSALGCNDQH
YLAARAVQFFLPGVPQVYYVGALAGRNDMELLRKTNNGRDINRHYYSTAEIDENLERPVV
KALNALAKFRNELPAFNGEFSYEADGDTSITFRWIAADGKTKAALIFEPGRGLGTDNTTP
VASLAWTDAAGDHETDDLLSNLPIADID
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaaagtgcagctcatcgcttacgccgatcgtctcggcgatggcactcttagc
tcgatgactgacatcctgcgcacccgcttcgacggcgtgtatgacggcgtgcatatcctg
ccgttcttcactccgttcgatggtgcggatgcaggcttcgacccgatcgaccacaccaaa
gtcgacccgcgtctcggcagctgggacgacgtcgctgaactttccaagacccacggcatc
atggtcgatgccatcgtcaaccacatgagctgggaatccaagcagttccaagacgtgctt
gaaaaaggtgaggaatccgagtattacccgatgtttctgaccatgagctccgtcttcccg
aacggcgccaccgaagaggaactggccggcatctaccgcccgcgcccgggcctgccgttc
acccactacaagttcgccggcaagacccgcctggtctgggtcagcttcactccgcagcag
gttgatattgacaccgattccgacaagggctgggaatacctcatgtccatcttcgatcag
atggccgcatcccacgtcagctacatccgtctcgacgccgtgggctacggcgccaaggag
gccggcaccagctgcttcatgacccccaagacctttaagctcatctcacgcctacgcgag
gaaggcgtcaagcgaggtctcgaaattctcattgaggtgcatagctactacaagaagcag
gttgaaatcgcctccaaggtggaccgcgtctacgacttcgccctgcctccgctgctcctg
cactcgctgttcaccggtcacgtggaacccgtggtccactggaccgaaatccgcccgaac
aacgccgtcaccgtgctcgatacgcacgacggcatcggcgtgatcgacatcggctccgat
cagctcgaccgcagcctcaagggcctcgtgcccgacgaggacgtcgataatctggtcaac
accatccacgccaacacccacggcgaatcccaggccgccaccggtgctgccgccagcaac
ctcgacctctatcaggtcaacagcacgtactactccgcgctcggctgcaacgaccagcac
tatctggccgcccgcgcagtccagttcttcctgcccggagtgccgcaggtctactacgtg
ggcgcgctcgccggccgcaacgacatggaactgctgcgcaagaccaacaacggccgtgac
atcaatcgccattactactccaccgccgaaatcgacgaaaacctcgagcgcccggtggtg
aaggccctgaacgccctggccaagttccgcaacgaactgcctgcattcaatggcgagttc
agctacgaagccgacggcgacacatccatcaccttccgctggatcgctgccgacggcaag
accaaggccgccctcatcttcgagcccggccgcggactcggcacggataacaccactccg
gtcgccagcctcgcctggaccgatgccgccggtgaccacgagactgatgatctgctgagc
aacctgccgattgccgatatcgactaa

DBGET integrated database retrieval system