KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0112Help
Entry
BLJ_0112          CDS       T01240                                 

Definition
(GenBank) extracellular solute-binding protein, family 1
  KO
K15770  arabinogalactan oligomer / maltooligosaccharide transport system substrate-binding protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll02010  ABC transporters
Module
bll_M00491  arabinogalactan oligomer/maltooligosaccharide transport system
Brite
KEGG Orthology (KO) [BR:bll00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    BLJ_0112
Transporters [BR:bll02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491] [OT]
    BLJ_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_1 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: ADG99605
UniProt: D6ZXF9
Position
148459..149703
Genome map
AA seq 414 aa AA seqDB search
MMARWKKALAAISACALFVTGLSACGSASAGGDAEHITLVVWASQEDQANTDSWLQTMEA
AFEQQHPEYSITWKNQNVASADAAGIAKQDPTVAADVYTFASDQLGTLLDAGAIGQVSDP
TMKQLEKQTKGNATMLQTVTGEDGNVYGVPLAGNTWFMYYRKSKFTEQDITSLDAMLAKG
KVSFPLTNSWYLPAFYIGAGGTLFGKDGTDAKSGVQFGGAIGAAVTDYLVDLRNNPNFVN
DKNGSGLAGLKSGKVDVVFTGNWDAATVRENLGDDWGVAKLPSFTLNGKQVQMKAFAGST
IYGWNPYTKHPVAADQFAAFLSGTESQRKHYKMRSVIPSDSELASDPAIEKDAVAQAQMD
TIAETSVVQPSIAEMNNFWVPCENFGNSIYNKEVTHANSAKLTEQWMASYQSLL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgatggcacgatggaagaaagccctggcggcgatttccgcctgtgcgctgttcgtcacg
ggcctgtccgcctgcgggtccgcaagcgcgggcggagacgcggagcatatcacgcttgtg
gtgtgggcctcccaagaggaccaagccaacacggattcgtggctgcagaccatggaggcc
gcattcgaacagcagcaccccgaatacagcatcacgtggaaaaaccagaacgtggcctcg
gcagacgccgccggcatagccaagcaggatccgaccgtagccgcagatgtttacacgttc
gccagcgaccagctgggcaccctgctcgatgccggtgccatcggccaggtgagcgacccg
acgatgaagcagctcgaaaaacagaccaaaggcaatgccacgatgctacagaccgtcacc
ggcgaggacggcaacgtctacggtgtgccgctggccggcaacacctggttcatgtactac
cgcaaaagcaagttcaccgagcaagacatcacctcgctggacgccatgctcgccaaaggc
aaggtctcattcccgctgaccaactcctggtatctgcccgccttctatatcggtgccggc
ggcacactgttcggcaaagacggcaccgacgccaagtcgggcgtgcagttcggcggtgca
atcggcgccgccgtcaccgattacctcgtcgacttgcgcaacaacccgaacttcgtcaac
gacaagaacggctccggcctggccgggctgaaaagcggcaaggtcgacgtggtcttcacc
ggcaactgggacgccgccacggtccgtgagaatctcggcgacgactggggcgtggccaag
ctgcccagcttcacgctcaacggcaagcaagtgcagatgaaggccttcgccggctccacc
atctacggctggaacccgtacaccaagcatccggtggccgccgaccagttcgccgcattc
ctgtccggcaccgaatcacagcgcaagcactataagatgcgttcggtgattccctcggac
agcgagcttgcctccgatccggccatcgagaaagacgccgtggcccaggcccagatggac
accatcgccgagacgtccgtggtgcaaccatccatcgccgagatgaacaacttctgggta
ccgtgcgagaacttcggcaattccatctacaacaaggaagtcacccacgccaactcggcc
aaactcaccgagcagtggatggcctcataccagagcctcctgtag

DBGET integrated database retrieval system