KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0114Help
Entry
BLJ_0114          CDS       T01240                                 

Definition
(GenBank) maltose/maltodextrin ABC superfamily ATP binding cassette transporter
  KO
K15772  arabinogalactan oligomer / maltooligosaccharide transport system permease protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll02010  ABC transporters
Module
bll_M00491  arabinogalactan oligomer/maltooligosaccharide transport system
Brite
KEGG Orthology (KO) [BR:bll00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BLJ_0114
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bll02000]
    BLJ_0114
Transporters [BR:bll02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Arabinogalactan oligomer/maltooligosaccharide transport system [MD:M00491] [OT]
    BLJ_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 YfhO
Motif
Other DBs
NCBI-ProteinID: ADG99607
UniProt: D6ZXG1
Position
151123..152049
Genome map
AA seq 308 aa AA seqDB search
MSSNAQTAIPRTDIATPKSASNPFWHDQRKRRIVGDVLSHLLLAVLAVIWVIPIVWVVLE
SFNKNPGPYNETFFPTEYTLDNYTKLFTDTHILNFPRMFMHTLVISIVVCLISVFFVLCV
AFCMSRMRFRFRKSFMNIVLVLGMFPGIMSVVVIYFILKSLGLTQGVGVTVALILVYSAG
AGAGFYVMKGYMDTIPMSLDEAAYLDGCTRWQVFIKIIIPVCKPMLVYQALTSFLGPWLD
FVMAKAIARTQDNYTVALGLYQMLSREYLNDWFARFAAAAVIISVPIAILFIVMQRFYQE
SMSGAVKG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaacgcgcagaccgcgatccctcgtaccgacatcgcaacccctaagtccgcc
agcaatccgttctggcatgaccaacgcaagcgccgcatcgtgggcgatgtcctaagccat
ctgttgctcgccgtgcttgcggtgatctgggtgattccgattgtgtgggtggtgctggag
agcttcaacaagaatcccggcccctacaacgagaccttcttccccaccgagtacacgctg
gacaactacaccaagctattcaccgacacccacatcctgaacttcccgcgcatgttcatg
catacgctggtgatttccatcgtggtgtgcctgatcagcgtgttcttcgtactgtgcgtg
gcgttctgcatgagccgcatgcgcttccgtttccgcaagtcgttcatgaacatcgtgctg
gtgctgggaatgttcccaggcatcatgtccgtggtagtgatctacttcatcctgaagtcg
ctgggcctgacccaaggtgtgggcgtcaccgtggcgttgattctcgtctactcggctggt
gccggcgcgggcttctacgtgatgaagggctacatggacacgattccgatgtcgcttgat
gaggccgcctaccttgacggatgcactcgctggcaggtgttcatcaagatcatcatcccg
gtgtgcaagccgatgctcgtctatcaggccctcacctcgttcttgggcccgtggcttgac
ttcgtgatggccaaggccatcgcccgcacgcaggataactacaccgtggcgctcggcctc
taccagatgctcagccgtgagtatctcaacgattggttcgcccgcttcgccgccgccgcg
gtaatcatctcggtcccgattgccatcctgttcatcgtcatgcagcgcttctaccaggag
tcgatgtctggcgcggtcaagggctag

DBGET integrated database retrieval system