KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0117Help
Entry
BLJ_0117          CDS       T01240                                 

Definition
(GenBank) putative ABC transport system membrane protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraX CPP1-like
Motif
Other DBs
NCBI-ProteinID: ADG99610
UniProt: D6ZXG4
Position
155185..155949
Genome map
AA seq 254 aa AA seqDB search
MNEVEMEKTRRGEQRRRKGLSVFRLKVIGAIFMALNVASVAILPALVDDPSQDMTALTAI
VLCAAASWIAVPIYSWLLFDGYRHTHNVWAYGLRLLVVAVVSEVPYDLIMAGKPFSLSVQ
NPVFGLLIALVVLALVDWLAKKYYGAFRWTLTVLVIIAGLLWDLLLHVGVDQRVLYTGVL
TLSFVMVFYFLNARENSMMFTAGLLGAVMCITPAIGVAFLHYRNGEQGFKQPWTKWAFYV
IYPVLLVFGALVAA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaagtcgaaatggagaagacgcggcgcggcgagcagcgccgtcgcaagggactg
tccgtgttccgtctcaaggtgatcggcgcgatcttcatggcgctcaacgtggcgagcgtc
gcgatactgcctgcgctggtggacgacccgagccaagacatgacagcgctgaccgcgatt
gtactgtgcgcggcggcttcctggatcgccgtgccgatctattcgtggctgttgttcgac
ggctaccgtcatacgcataacgtatgggcgtacgggctgcgactgctcgtcgtggccgtg
gtcagcgaggtgccatacgacctgatcatggccggcaagcccttcagcctgagtgtgcag
aacccggtgttcggactgctcatcgccctggtcgtgctggcgctggtggactggctggcc
aagaaatactacggcgccttccgctggacgctgactgtgctggtcattatcgcgggcctg
ctgtgggatttgctgctgcatgtgggcgtggatcagcgcgtgctgtacacgggcgtgctc
acgctgtcgttcgtgatggtgttctacttcctcaacgcacgcgagaattcgatgatgttc
accgccgggctgctgggcgcggtgatgtgcatcacgcccgccatcggcgtggccttcctg
cactaccgcaacggcgagcagggtttcaagcaaccatggaccaagtgggcgttctatgtg
atctacccggtactgctggtgtttggcgcgttggtggcggcgtag

DBGET integrated database retrieval system