KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0129Help
Entry
BLJ_0129          CDS       T01240                                 

Definition
(GenBank) ABC-type sugar transport system, permease component
  KO
K10119  raffinose/stachyose/melibiose transport system permease protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Pathway
bll02010  ABC transporters
Module
bll_M00196  Raffinose/stachyose/melibiose transport system
Brite
KEGG Orthology (KO) [BR:bll00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BLJ_0129
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bll02000]
    BLJ_0129
Transporters [BR:bll02000]
 ABC Transporters, Prokaryotic Type
  Saccharide, polyol, and lipid transporters
   Raffinose/stachyose/melibiose transporter [MD:M00196] [OT]
    BLJ_0129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ADG99622
UniProt: D6ZXH6
Position
167682..168482
Genome map
AA seq 266 aa AA seqDB search
MKRKTSATVIMYTVLVFFFVIWIFPIYTAITKSLQAGGWNSYLSVINNKDVHYFRVVFNS
FFISVVTAVIVVVITSLAGYAFAKMKFTGSQVIYVLLLACMAVPIASVTMPLFFTIKTFG
LTNTYLGMIIPLVAFNALQMLLLWRNYFNGVPDEIIEAARVDGCGSLRIWARILMPISTP
MIATTGVLTFVYSWNEYLIPLLLIRDESKYPVTLASTYFMETRSQTPEMVAQEYAALILM
TIPSIIVYLISQKWLQSGITAGAVKS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgtaaaaccagtgcgacggtcatcatgtacaccgtcctcgtattcttcttcgtc
atctggattttcccgatttacacggcaatcaccaagtccctgcaggcaggcggctggaac
agctacctgtccgtgatcaacaataaggacgtgcactacttccgcgtggtgttcaacagc
tttttcatctccgtggtcaccgccgtgatcgtggtggtcatcacctcgctcgccggctac
gcctttgccaagatgaagttcaccggttcccaggtgatctacgtgctgctgctcgcctgc
atggccgtgccgattgcctccgtgaccatgccgctgttcttcaccatcaagacattcggc
ctgaccaacacctacctcggcatgatcatcccgttggtggcgttcaacgccctgcagatg
ctgttgctctggcgcaactacttcaacggcgtgccagacgaaatcatcgaagccgcccgc
gtggacggctgcggttccctgcgcatctgggctcgtatcttgatgcctatctccaccccg
atgatcgccaccaccggcgtgctgaccttcgtctactcctggaacgaatacctgattccg
ttgctgctcatccgcgacgaatccaagtatccggtcacgctggcctccacctacttcatg
gagacccgcagccagacgccggagatggtggcccaggaatacgccgccctgattctgatg
acgattccgtccatcatcgtctacctgatcagccagaagtggctgcagtccggcatcacc
gccggcgccgtcaagagctga

DBGET integrated database retrieval system