KEGG   Bifidobacterium longum subsp. longum JDM301: BLJ_0133Help
Entry
BLJ_0133          CDS       T01240                                 

Definition
(GenBank) DedA integral membrane protein
  KO
K03975  membrane-associated protein
Organism
bll  Bifidobacterium longum subsp. longum JDM301
Brite
KEGG Orthology (KO) [BR:bll00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BLJ_0133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SNARE_assoc
Motif
Other DBs
NCBI-ProteinID: ADG99626
UniProt: D6ZXI0
Position
173569..174294
Genome map
AA seq 241 aa AA seqDB search
MGFVNFILELLKDPRAAIAGWIAMGVAPTLGFIFLIVFIETGVVFFPFLPGDSLLFAAGV
FAAPDAATGKAALPLFWLLPVVWCAPIIGDQCNYFIGHFFGRRIIQSGKVKALTPERLAK
TEHMIEKWGPLAVFLGRFFPFIRTFMPFISGISGMRWSRFTPFSVLGGLCWSTLFTLLGY
FFGNIPAVQDHFELVIVLILLVSLAPTIIGLLKAKFGKKKPAKVTDAQLDAMEDGIKNLD
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgggcttcgttaatttcatcctcgaactgctgaaggatccgcgtgccgcgattgccggt
tggattgccatgggcgtggcgccgaccctcggattcatcttcctcatcgtattcatcgaa
acgggcgtggtgttcttcccgttcctgccgggcgactccctgctgttcgccgccggtgtg
ttcgccgctcccgatgccgcgaccggcaaggccgcgctgccgctgttctggctgctgccg
gtggtctggtgcgccccgattatcggcgaccagtgcaattacttcattggtcatttcttc
ggccgtcgcatcatccagtccggcaaggtgaaggccttgaccccggagcgtttggccaaa
accgagcacatgattgagaagtggggcccgctggccgtgttcctgggccgtttcttcccg
ttcattcgtacgttcatgccgttcatctccggtatttccggtatgcgttggagccgtttc
acgccgttctcagtgctcggcggcctgtgctggtccacgttgttcacgctgctgggctac
ttcttcggtaacattccggcagtacaggaccacttcgagctggtgatcgtgctgattctg
ctggtctcgctcgccccgaccatcatcggtctgctcaaggccaagttcggcaagaagaag
ccggccaaggtgaccgatgctcagttggatgctatggaagacggcattaagaacctcgat
aagtaa

DBGET integrated database retrieval system